Homologs in group_1954

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14660 FBDBKF_14660 100.0 Morganella morganii S1 nagZ beta-N-acetylhexosaminidase
NLDBIP_15995 NLDBIP_15995 100.0 Morganella morganii S4 nagZ beta-N-acetylhexosaminidase
LHKJJB_15845 LHKJJB_15845 100.0 Morganella morganii S3 nagZ beta-N-acetylhexosaminidase
HKOGLL_14965 HKOGLL_14965 100.0 Morganella morganii S5 nagZ beta-N-acetylhexosaminidase
F4V73_RS07455 F4V73_RS07455 93.5 Morganella psychrotolerans nagZ beta-N-acetylhexosaminidase
PMI_RS04285 PMI_RS04285 74.6 Proteus mirabilis HI4320 nagZ beta-N-acetylhexosaminidase

Distribution of the homologs in the orthogroup group_1954

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1954

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVE7 0.0 532 74 1 340 3 nagZ Beta-hexosaminidase Proteus mirabilis (strain HI4320)
Q7N397 0.0 526 73 1 340 3 nagZ Beta-hexosaminidase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P75949 2.98e-177 497 70 2 338 1 nagZ Beta-hexosaminidase Escherichia coli (strain K12)
B1XA17 2.98e-177 497 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain K12 / DH10B)
C4ZS47 2.98e-177 497 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain K12 / MC4100 / BW2952)
Q32EW7 1.12e-176 496 70 2 338 3 nagZ Beta-hexosaminidase Shigella dysenteriae serotype 1 (strain Sd197)
B1JI47 3.48e-176 494 72 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FH41 3.48e-176 494 72 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JME4 3.53e-176 494 72 2 336 3 nagZ Beta-hexosaminidase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q31ZG4 5.13e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Shigella boydii serotype 4 (strain Sb227)
B2U513 5.13e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YVX6 5.48e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58067 5.48e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O157:H7
B1LI37 5.98e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain SMS-3-5 / SECEC)
B7NAY5 5.98e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NKH2 5.98e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7ZKL1 6.53e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7UCW4 8.03e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Shigella flexneri
Q1RD47 8.03e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain UTI89 / UPEC)
B7MJ94 8.03e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O45:K1 (strain S88 / ExPEC)
B6I9I5 8.39e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain SE11)
B7LX41 8.39e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O8 (strain IAI1)
B7LG40 8.39e-176 494 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain 55989 / EAEC)
B1IUF8 9.68e-176 493 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ65 9.68e-176 493 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O9:H4 (strain HS)
B7MTN7 1.06e-175 493 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O81 (strain ED1a)
B7UPC3 1.06e-175 493 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5XXG4 1.88e-175 493 70 2 338 3 nagZ Beta-hexosaminidase Klebsiella pneumoniae (strain 342)
Q3Z310 2.3e-175 493 70 2 338 3 nagZ Beta-hexosaminidase Shigella sonnei (strain Ss046)
Q8ZFS3 2.73e-175 492 72 2 336 3 nagZ Beta-hexosaminidase Yersinia pestis
Q669N5 4.36e-175 492 72 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K731 4.36e-175 492 72 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7MFT1 1.43e-174 490 70 2 337 3 nagZ Beta-hexosaminidase Cronobacter sakazakii (strain ATCC BAA-894)
A1AA01 1.48e-174 490 70 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O1:K1 / APEC
Q8FIN2 4.98e-174 489 69 2 338 3 nagZ Beta-hexosaminidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZQ06 1.25e-173 488 70 2 338 1 nagZ Beta-hexosaminidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTH9 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella schwarzengrund (strain CVM19633)
A9N5J6 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3P6 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella newport (strain SL254)
B4TFI4 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella heidelberg (strain SL476)
B5RB93 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXC7 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella enteritidis PT4 (strain P125109)
B5FK98 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella dublin (strain CT_02021853)
Q57QE6 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella choleraesuis (strain SC-B67)
B5F8E5 1.25e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella agona (strain SL483)
Q8Z7I6 1.56e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella typhi
Q5PGT0 1.56e-173 488 70 2 338 3 nagZ Beta-hexosaminidase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7LT32 9.47e-173 486 69 2 338 3 nagZ Beta-hexosaminidase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VDM3 3.96e-172 484 69 2 336 3 nagZ Beta-hexosaminidase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D674 1.57e-171 483 68 2 337 3 nagZ Beta-hexosaminidase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DKR8 2.86e-171 482 68 2 337 3 nagZ Beta-hexosaminidase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BFM6 5.12e-158 448 65 2 338 3 nagZ Beta-hexosaminidase Edwardsiella ictaluri (strain 93-146)
C3LSU7 6.01e-140 402 57 4 338 3 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU37 6.01e-140 402 57 4 338 1 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8Y1 3.58e-138 398 57 4 336 3 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LJ30 6.62e-136 392 55 4 339 3 nagZ Beta-hexosaminidase Photobacterium profundum (strain SS9)
P96157 1.52e-135 391 58 4 332 1 nagZ Beta-hexosaminidase Vibrio furnissii
B8F5N0 3.82e-133 385 55 3 338 3 nagZ Beta-hexosaminidase Glaesserella parasuis serovar 5 (strain SH0165)
C4LEY6 5.81e-131 380 55 3 336 3 nagZ Beta-hexosaminidase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q9CPH0 9.86e-129 375 51 4 345 3 nagZ Beta-hexosaminidase Pasteurella multocida (strain Pm70)
Q0I414 1.47e-123 362 51 4 345 3 nagZ Beta-hexosaminidase Histophilus somni (strain 129Pt)
B0UTC6 1.52e-123 361 51 4 345 3 nagZ Beta-hexosaminidase Histophilus somni (strain 2336)
B0BQ51 1.82e-123 361 52 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXZ7 5.61e-123 360 51 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1B7 5.61e-123 360 51 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VKU4 5.03e-122 357 50 4 346 3 nagZ Beta-hexosaminidase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1SW90 8.13e-121 354 52 4 339 3 nagZ Beta-hexosaminidase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q65VK7 1.38e-118 348 51 5 345 3 nagZ Beta-hexosaminidase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4QLU8 1.83e-115 341 50 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain 86-028NP)
A5UDA9 8.04e-115 339 50 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain PittEE)
P44955 1.14e-114 339 49 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VNI8 1.48e-112 333 50 3 339 3 nagZ Beta-hexosaminidase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8GSD2 5.35e-109 324 51 8 340 3 nagZ Beta-hexosaminidase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q5QUZ5 6.66e-108 321 49 4 333 3 nagZ Beta-hexosaminidase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0HJG7 8.73e-105 313 47 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain MR-4)
Q8EEW2 1.28e-103 310 48 4 341 3 nagZ Beta-hexosaminidase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HVQ8 2.05e-103 310 48 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain MR-7)
A0KXK3 3.53e-103 309 46 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain ANA-3)
Q1H075 1.11e-100 303 52 5 308 3 nagZ Beta-hexosaminidase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0A911 2.28e-100 302 48 5 333 3 nagZ Beta-hexosaminidase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9HZK0 9.56e-99 298 50 6 332 1 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PG9 9.56e-99 298 50 6 332 3 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYS5 9.56e-99 298 50 6 332 3 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain LESB58)
Q2Y863 1.18e-97 295 46 5 337 3 nagZ Beta-hexosaminidase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7W9J5 5.7e-97 294 48 6 337 3 nagZ Beta-hexosaminidase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WH65 5.7e-97 294 48 6 337 3 nagZ Beta-hexosaminidase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3J953 8.87e-97 293 48 8 343 3 nagZ Beta-hexosaminidase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q080R9 4.73e-96 291 46 3 329 3 nagZ Beta-hexosaminidase Shewanella frigidimarina (strain NCIMB 400)
Q2KXM7 1.36e-95 290 48 7 336 3 nagZ Beta-hexosaminidase Bordetella avium (strain 197N)
Q7VWV8 2.58e-94 287 48 7 337 3 nagZ Beta-hexosaminidase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q3SKU2 9.53e-94 286 47 6 333 3 nagZ Beta-hexosaminidase Thiobacillus denitrificans (strain ATCC 25259)
Q0AF74 4.08e-92 281 44 5 337 3 nagZ Beta-hexosaminidase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9JVT3 4.29e-92 282 51 4 284 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5P081 5.77e-91 279 47 7 342 3 nagZ Beta-hexosaminidase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q82SJ8 6.57e-91 278 45 5 337 3 nagZ Beta-hexosaminidase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7NWB7 1.05e-90 278 47 5 330 3 nagZ Beta-hexosaminidase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B4RQ67 1.57e-89 275 49 4 284 3 nagZ Beta-hexosaminidase Neisseria gonorrhoeae (strain NCCP11945)
A9M1Z4 2.01e-87 270 49 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup C (strain 053442)
Q31G32 2.28e-87 270 45 7 331 3 nagZ Beta-hexosaminidase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9K0Q4 6.77e-87 268 49 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5FA94 1.03e-86 268 49 5 285 1 nagZ Beta-hexosaminidase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KSD9 1.08e-86 268 48 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q606N2 8.65e-86 265 44 6 339 3 nagZ Beta-hexosaminidase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B2FPW9 6.34e-77 242 47 3 280 3 nagZ Beta-hexosaminidase Stenotrophomonas maltophilia (strain K279a)
B4SRK3 9.15e-77 241 46 3 280 3 nagZ Beta-hexosaminidase Stenotrophomonas maltophilia (strain R551-3)
Q3BVU6 5.73e-72 229 46 4 280 3 nagZ Beta-hexosaminidase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMU1 3.15e-71 227 45 4 280 3 nagZ Beta-hexosaminidase Xanthomonas axonopodis pv. citri (strain 306)
Q5H1Q0 1.02e-70 226 42 5 302 3 nagZ Beta-hexosaminidase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4L0 1.4e-70 226 42 5 302 3 nagZ Beta-hexosaminidase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PB42 3.45e-70 224 45 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RX17 3.45e-70 224 45 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain B100)
Q4USG7 3.45e-70 224 45 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain 8004)
Q9PAZ0 1.29e-68 221 43 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain 9a5c)
Q87BR5 6.87e-67 216 43 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6G9 6.87e-67 216 43 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain M23)
B0U3L0 1.24e-65 213 43 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain M12)
P48823 2.62e-32 130 28 6 290 1 cht60 Beta-hexosaminidase A Pseudoalteromonas piscicida
P40406 3.52e-30 124 28 5 283 1 nagZ Beta-hexosaminidase Bacillus subtilis (strain 168)
D4AQ52 5.81e-21 95 29 9 282 1 ARB_06359 Uncharacterized secreted glycosyl hydrolase ARB_06359 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
L7N6B0 6.02e-17 84 31 10 250 1 lpqI Beta-hexosaminidase LpqI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A0H3M1P5 1.54e-16 83 30 10 250 3 lpqI Beta-hexosaminidase LpqI Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7WUL3 1.46e-09 62 25 10 279 1 nag3 Beta-N-acetylglucosaminidase/beta-glucosidase Cellulomonas fimi
P27034 5.34e-08 58 26 4 155 3 cbg-1 Beta-glucosidase Rhizobium radiobacter
T2KMH0 3.79e-07 55 27 7 197 1 BN863_22130 Beta-xylosidase Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q2UFP8 1.68e-06 53 25 8 228 3 bglC Probable beta-glucosidase C Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B8NGU6 2.09e-06 53 25 8 228 3 bglC Probable beta-glucosidase C Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P07337 1.52e-05 50 27 3 154 3 None Beta-glucosidase Kluyveromyces marxianus
E7CY69 2.42e-05 49 24 7 215 1 apy Exo-alpha-(1->6)-L-arabinopyranosidase Bifidobacterium longum
A1DFA8 3.72e-05 49 26 8 193 3 bglI Probable beta-glucosidase I Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q5BFG8 8.99e-05 48 26 8 220 1 bglB Beta-glucosidase B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A5ABF5 0.000108 47 25 7 199 3 bglM Probable beta-glucosidase M Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A1CA51 0.000123 47 27 10 202 3 bglI Probable beta-glucosidase I Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P33363 0.000173 47 29 6 144 3 bglX Periplasmic beta-glucosidase Escherichia coli (strain K12)
Q56078 0.000204 47 25 6 177 3 bglX Periplasmic beta-glucosidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F6C6C1 0.00022 46 25 7 187 1 HMPREF9228_1477 Exo-alpha-(1->6)-L-arabinopyranosidase Bifidobacterium breve (strain ACS-071-V-Sch8b)
Q4WU49 0.000251 46 25 8 193 3 bglI Probable beta-glucosidase I Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0Y3M6 0.000276 46 25 8 193 3 bglI Probable beta-glucosidase I Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
A2R989 0.00039 45 25 8 194 3 bglI Probable beta-glucosidase I Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q0CAF5 0.000436 45 25 8 192 3 bglI Probable beta-glucosidase I Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5BA18 0.000712 45 26 6 189 2 bglK Probable beta-glucosidase K Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BB53 0.000718 45 24 7 190 2 bglI Probable beta-glucosidase I Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P14002 0.001 44 24 5 181 1 bglB Thermostable beta-glucosidase B Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_15465
Feature type CDS
Gene nagZ
Product beta-N-acetylhexosaminidase
Location 61805 - 62827 (strand: -1)
Length 1023 (nucleotides) / 340 (amino acids)

Contig

Accession ZDB_226
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1954
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00933 Glycosyl hydrolase family 3 N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1472 Carbohydrate transport and metabolism (G) G Periplasmic beta-glucosidase and related glycosidases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01207 beta-N-acetylhexosaminidase [EC:3.2.1.52] Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
beta-Lactam resistance		 -

Protein Sequence

MGPVMLDVEGYELDSEEREILRHPSVGGVILFTRNFHDTAQLRELTRQIREATRDNRVVIAVDQEGGRVQRFKDGFTRLPAAQSFAQFNDLLTGSALAEEAGWLMAAEMIAMDIDISFAPVLDLGHGSAAIGSRAFHEDGDIAAQMAERFVRGMRSAGMSSTGKHFPGHGAVSADSHKETPRDERDPAVIRGKDMAIFREFIQRGLLDAVMPAHVIYTQIDDRPASGSSYWLKSVLRQQLGFDGVIFSDDLSMEGAAVMGGYAERGQASLDAGCDMILVCNNRKGAVTILDNLPVITAQRIDKLYHRSKGYDLAELQRSERWQQANKTLSVLHEQWQERA

Flanking regions ( +/- flanking 50bp)

CCGCGCTGAAAGCCGCCGCCGGGCTCAGGTAAATACAACGAGGTTTCACCATGGGTCCTGTAATGTTAGATGTCGAAGGGTATGAGCTGGACAGCGAAGAGCGCGAGATCCTGCGCCACCCTTCAGTCGGGGGAGTGATTCTCTTTACCCGTAATTTCCATGACACGGCACAGCTGCGGGAACTGACGCGGCAGATCCGTGAAGCCACCCGCGACAACCGGGTTGTGATTGCGGTTGACCAGGAGGGCGGCCGCGTCCAGCGGTTTAAAGATGGCTTTACCCGCCTGCCGGCGGCACAGTCTTTTGCACAGTTTAATGACCTGCTCACCGGCTCTGCGCTGGCGGAAGAGGCGGGCTGGCTGATGGCGGCGGAAATGATCGCTATGGATATTGATATCAGTTTCGCGCCGGTGCTGGATCTGGGGCACGGCAGCGCGGCTATCGGCTCACGCGCGTTCCATGAGGACGGCGACATTGCGGCGCAGATGGCGGAACGCTTTGTGCGCGGTATGCGCAGTGCCGGGATGTCGAGTACCGGTAAACATTTCCCGGGACACGGCGCGGTCAGTGCGGATTCCCACAAGGAAACGCCGCGTGATGAGCGCGACCCGGCGGTGATCCGCGGCAAAGACATGGCAATTTTCCGTGAGTTTATCCAGCGCGGTCTGCTTGATGCTGTGATGCCCGCACATGTGATTTACACACAGATTGATGATCGCCCGGCGAGCGGTTCATCCTACTGGCTGAAATCGGTGCTGCGTCAGCAACTCGGGTTTGACGGGGTTATTTTCTCTGATGACCTGTCAATGGAAGGGGCGGCGGTGATGGGCGGCTATGCGGAGCGTGGTCAGGCATCTCTCGACGCGGGCTGCGATATGATCCTGGTCTGTAATAACCGCAAAGGTGCTGTGACTATCCTTGATAATTTGCCTGTTATCACGGCACAACGTATTGATAAGTTGTATCATCGGAGTAAAGGTTATGATCTGGCTGAACTGCAGCGCAGTGAGCGCTGGCAGCAGGCGAACAAAACCCTATCCGTATTACACGAACAATGGCAGGAGCGAGCATGATTATTTATCTTCATGGATTTGATTCAACCAGCCCGGGCAATCATGAAAAA