Homologs in group_1652

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10490 FBDBKF_10490 100.0 Morganella morganii S1 yjcH DUF485 domain-containing protein
NLDBIP_14655 NLDBIP_14655 100.0 Morganella morganii S4 yjcH DUF485 domain-containing protein
LHKJJB_14690 LHKJJB_14690 100.0 Morganella morganii S3 yjcH DUF485 domain-containing protein
HKOGLL_13310 HKOGLL_13310 100.0 Morganella morganii S5 yjcH DUF485 domain-containing protein
F4V73_RS14200 F4V73_RS14200 87.4 Morganella psychrotolerans - DUF485 domain-containing protein
PMI_RS15030 PMI_RS15030 70.9 Proteus mirabilis HI4320 - DUF485 domain-containing protein

Distribution of the homologs in the orthogroup group_1652

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1652

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AF55 2.87e-38 126 57 0 102 3 yjcH Inner membrane protein YjcH Shigella flexneri
P0AF54 2.87e-38 126 57 0 102 1 yjcH Inner membrane protein YjcH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14825
Feature type CDS
Gene yjcH
Product DUF485 domain-containing protein
Location 54782 - 55093 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession ZDB_225
Length 129223 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1652
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04341 Protein of unknown function, DUF485

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3162 Function unknown (S) S Uncharacterized membrane protein, DUF485 family

Protein Sequence

MSASIYQQVENDPRFQELVRKRSRFSWTLSAITLVLYVSFIILIAFDPQWLGTPLGEGLTITRGIPVGVGLIVSAFVLTGIYTIRANGEFDRLTAEIISGVKQ

Flanking regions ( +/- flanking 50bp)

CATTGTGCGGCACTGACACTCCGGATAACAAAAACAGAGGAGTATCCTCAATGAGCGCATCCATTTATCAGCAGGTGGAGAACGACCCTCGCTTTCAGGAACTGGTCAGAAAGCGCAGTCGGTTCTCATGGACATTGTCCGCTATCACACTTGTGCTGTATGTCAGCTTTATTATTCTGATTGCATTTGACCCGCAATGGCTGGGTACGCCACTCGGCGAAGGTCTGACGATTACCCGCGGGATACCTGTCGGCGTCGGGCTGATTGTCAGTGCGTTTGTCCTGACCGGTATTTATACCATCCGCGCAAACGGTGAATTCGACCGTCTGACCGCCGAAATCATCAGCGGGGTGAAACAATGAAAATGCGCCTTTCTGCTCTTCTGTTATCCCTGCTGTTTCCGCTGCTCAGT