Homologs in group_1737

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12120 FBDBKF_12120 100.0 Morganella morganii S1 sWEET Sugar transporter, SemiSWEET family, contains PQ motif
NLDBIP_15280 NLDBIP_15280 100.0 Morganella morganii S4 sWEET Sugar transporter, SemiSWEET family, contains PQ motif
LHKJJB_15330 LHKJJB_15330 100.0 Morganella morganii S3 sWEET Sugar transporter, SemiSWEET family, contains PQ motif
HKOGLL_14450 HKOGLL_14450 100.0 Morganella morganii S5 sWEET Sugar transporter, SemiSWEET family, contains PQ motif
F4V73_RS14520 F4V73_RS14520 83.7 Morganella psychrotolerans - SemiSWEET family transporter
PMI_RS13965 PMI_RS13965 59.3 Proteus mirabilis HI4320 - SemiSWEET family transporter

Distribution of the homologs in the orthogroup group_1737

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1737

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZV02 0.00046 40 29 3 86 1 SWEET9 Bidirectional sugar transporter SWEET9 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14185
Feature type CDS
Gene sWEET
Product Sugar transporter, SemiSWEET family, contains PQ motif
Location 54416 - 54694 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1737
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03083 Sugar efflux transporter for intercellular exchange

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4095 Carbohydrate transport and metabolism (G) G Sugar transporter, SemiSWEET family, contains PQ motif

Protein Sequence

MSDTKRPPHDHSRFIRCLGWVATFTAFCMYVSYIPQIMDNLAGHKTSPLQPLAAAFNCTLWVIYGLKVKDLPVAVANAPGVLFGLAAMLTAL

Flanking regions ( +/- flanking 50bp)

TCTGAAGAGTAATACGGGATTATGCTGATGCTGTTCACCGGGAGAAACCAATGAGTGATACAAAACGTCCGCCGCACGATCACAGCCGCTTTATCCGCTGCCTCGGCTGGGTGGCAACCTTTACGGCATTTTGTATGTATGTCTCCTATATTCCACAGATTATGGATAATCTGGCGGGACATAAAACGTCACCGCTGCAGCCGCTGGCTGCCGCATTTAACTGTACACTTTGGGTGATTTACGGCCTTAAAGTGAAAGATCTGCCGGTTGCGGTCGCCAATGCCCCCGGTGTCCTGTTCGGGCTGGCGGCGATGCTGACTGCATTATAGTGATCCGTCTGATTATCCGTCTGTGGCACGATCATATTAATCGGGCGGCA