Homologs in group_1300

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07955 FBDBKF_07955 100.0 Morganella morganii S1 hpt hypoxanthine phosphoribosyltransferase
NLDBIP_14230 NLDBIP_14230 100.0 Morganella morganii S4 hpt hypoxanthine phosphoribosyltransferase
LHKJJB_08620 LHKJJB_08620 100.0 Morganella morganii S3 hpt hypoxanthine phosphoribosyltransferase
HKOGLL_08170 HKOGLL_08170 100.0 Morganella morganii S5 hpt hypoxanthine phosphoribosyltransferase
F4V73_RS13030 F4V73_RS13030 96.1 Morganella psychrotolerans hpt hypoxanthine phosphoribosyltransferase
PMI_RS00775 PMI_RS00775 80.3 Proteus mirabilis HI4320 hpt hypoxanthine phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_1300

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1300

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O33799 2.13e-97 282 74 0 177 1 hpt Hypoxanthine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9M4 1.87e-95 277 73 0 177 3 hpt Hypoxanthine phosphoribosyltransferase Shigella flexneri
P0A9M2 1.87e-95 277 73 0 177 1 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli (strain K12)
P0A9M3 1.87e-95 277 73 0 177 3 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P18134 1.25e-84 249 67 1 172 3 hpt Hypoxanthine phosphoribosyltransferase Vibrio harveyi
Q8K9U8 4.06e-78 233 62 0 174 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P45078 8.2e-78 232 62 1 179 3 hpt Hypoxanthine phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57291 5.37e-76 228 61 1 175 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P37171 4.7e-64 197 54 1 171 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q839B2 1.71e-54 173 50 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CQV4 1.03e-52 169 49 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP4 1.03e-52 169 49 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P65828 2.68e-52 168 49 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MW2)
Q6GBX8 2.68e-52 168 49 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GJG1 2.68e-52 168 49 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MRSA252)
P99085 2.68e-52 168 49 1 166 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain N315)
P65827 2.68e-52 168 49 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG5 2.68e-52 168 49 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain COL)
Q54NJ8 3.97e-52 167 47 2 171 1 hprT Hypoxanthine-guanine phosphoribosyltransferase Dictyostelium discoideum
Q8E2H3 4.93e-52 167 49 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y1 4.93e-52 167 49 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q92F56 1.29e-51 177 51 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DWM8 1.87e-51 166 46 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q724J4 4.1e-51 176 50 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serotype 4b (strain F2365)
Q8YAC7 4.5e-51 176 50 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P37472 1.71e-48 158 50 2 173 3 hprT Hypoxanthine-guanine phosphoribosyltransferase Bacillus subtilis (strain 168)
Q5M6K8 3.59e-48 157 45 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M216 3.59e-48 157 45 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q8DRP8 4.72e-48 157 47 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97TC4 4.72e-48 157 47 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O66821 8.35e-48 156 48 1 158 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Aquifex aeolicus (strain VF5)
P0DD41 8.29e-44 146 47 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q7CNQ9 8.29e-44 146 47 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEL6 8.29e-44 146 47 1 164 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD40 8.29e-44 146 47 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q02522 1.03e-43 146 47 2 151 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
O69537 7.85e-43 144 48 1 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium leprae (strain TN)
P96794 8.02e-43 144 50 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium avium
P9WHQ9 9.87e-42 142 48 1 168 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0A5T1 9.87e-42 142 48 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ8 1.79e-41 141 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P51900 2.14e-40 137 39 3 165 1 HPT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Tritrichomonas foetus
P43152 4.31e-34 122 38 3 175 3 None Hypoxanthine-guanine phosphoribosyltransferase Leishmania donovani
P75119 3.25e-32 116 34 1 161 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q27541 6.73e-32 117 36 2 168 3 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Crithidia fasciculata
P47696 1.2e-30 112 32 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q07010 1.66e-30 113 39 2 168 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Trypanosoma brucei brucei
Q6WIT9 1.32e-22 93 36 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Canis lupus familiaris
Q45FY6 1.41e-22 93 36 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Sus scrofa
P27605 1.58e-22 92 36 6 174 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Rattus norvegicus
Q3SZ18 1.69e-22 92 36 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Bos taurus
P00493 1.76e-22 92 36 6 174 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Mus musculus
Q6LDD9 1.8e-22 92 36 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Macaca fascicularis
P00492 1.8e-22 92 36 6 174 1 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Homo sapiens
Q64531 1.86e-22 92 36 6 174 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase (Fragment) Mus spretus
P47959 2.93e-22 92 36 7 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Meriones unguiculatus
A5A6I1 4.2e-22 91 36 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Pan troglodytes
Q9W719 4.62e-22 91 34 6 193 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Gallus gallus
P00494 1.17e-20 88 35 6 174 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Cricetulus griseus
P07833 5.54e-17 78 32 3 179 2 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate K1 / Thailand)
P20035 6.47e-17 78 32 3 179 1 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate FCR-3 / Gambia)
P09383 4.27e-16 77 30 4 181 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Schistosoma mansoni
Q9NRG1 9.78e-15 72 28 3 181 1 PRTFDC1 Phosphoribosyltransferase domain-containing protein 1 Homo sapiens
Q6DCP3 1.93e-13 68 31 3 145 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus laevis
Q26997 3.01e-13 68 31 5 177 1 HPRT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Toxoplasma gondii
A4II60 6.04e-13 67 31 3 145 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus tropicalis
Q5QW45 2.6e-05 45 26 6 141 3 gpt Xanthine-guanine phosphoribosyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q28PG8 9.39e-05 44 29 3 111 3 gpt Xanthine-guanine phosphoribosyltransferase Jannaschia sp. (strain CCS1)
Q1GHI7 0.000121 44 27 7 158 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria sp. (strain TM1040)
Q163Y8 0.000163 43 33 5 102 3 gpt Xanthine-guanine phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1VES8 0.000378 42 27 4 100 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
C3LQ49 0.000559 42 27 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPT5 0.000559 42 27 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y8 0.000559 42 27 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VJB5 0.000593 42 34 6 93 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
Q7N7B4 0.000812 41 26 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q87RV3 0.001 41 31 5 95 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13785
Feature type CDS
Gene hpt
Product hypoxanthine phosphoribosyltransferase
Location 97066 - 97605 (strand: 1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession ZDB_223
Length 138954 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1300
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0634 Nucleotide transport and metabolism (F) F Hypoxanthine-guanine phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00760 hypoxanthine phosphoribosyltransferase [EC:2.4.2.8] Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of secondary metabolites
Nucleotide metabolism		 -

Protein Sequence

MKKHTLDTMISEAEIQQRVADLGSEISAHYRHSNKELVLVGLLKGSFIFMADLCRKIDVPHEVDFMTVSSYGSGTSSTRDVKIVKDLDEDIRGKDVLIVEDIIDSGNTLHRVRDILSLRGPNSVAICTLLDKPSRREVDVPVDWVGYAIEDKFVVGYGIDYAQSYRHLPYIGHVTLLEE

Flanking regions ( +/- flanking 50bp)

GGTTTAATGCCGAACCACTGAAACAGCGTACCGTTGACGACAAAAAAATCATGAAGAAACACACCTTAGATACAATGATCTCCGAAGCTGAGATTCAGCAGCGCGTTGCCGATCTCGGCAGCGAAATTTCCGCACACTATCGTCACAGCAACAAAGAGCTGGTCTTAGTCGGGTTACTGAAAGGATCTTTTATTTTTATGGCCGATCTGTGCCGTAAAATTGATGTTCCGCATGAAGTCGATTTTATGACGGTATCCAGTTACGGCAGCGGCACCTCGTCCACCCGTGATGTGAAAATTGTCAAAGACCTGGACGAAGATATCCGCGGCAAAGACGTGCTGATCGTGGAAGATATCATTGATTCCGGCAATACACTGCACCGCGTGCGCGACATTCTGTCTCTGCGCGGCCCGAACTCTGTGGCTATCTGCACCCTGCTGGATAAACCGTCCCGCCGTGAAGTGGATGTGCCGGTTGACTGGGTCGGCTACGCAATCGAAGACAAATTTGTGGTCGGTTACGGCATCGACTACGCCCAGAGCTACCGCCACCTGCCGTATATCGGCCATGTGACACTGCTGGAAGAGTAATGTGTCCGGTTGTGAATATAAAAACGGCACCCGAAGGTGCCGTTTGCTTT