Homologs in group_1419

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08765 FBDBKF_08765 100.0 Morganella morganii S1 yhbQ putative endonuclease, GIY-YIG superfamily
NLDBIP_13100 NLDBIP_13100 100.0 Morganella morganii S4 yhbQ putative endonuclease, GIY-YIG superfamily
LHKJJB_13455 LHKJJB_13455 100.0 Morganella morganii S3 yhbQ putative endonuclease, GIY-YIG superfamily
HKOGLL_11575 HKOGLL_11575 100.0 Morganella morganii S5 yhbQ putative endonuclease, GIY-YIG superfamily
F4V73_RS09980 F4V73_RS09980 82.1 Morganella psychrotolerans - GIY-YIG nuclease family protein
PMI_RS17170 PMI_RS17170 50.5 Proteus mirabilis HI4320 - GIY-YIG nuclease family protein

Distribution of the homologs in the orthogroup group_1419

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1419

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2K2S3 1.32e-31 109 63 0 87 3 YPTS_0528 UPF0213 protein YPTS_0528 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66F42 1.32e-31 109 63 0 87 3 YPTB0498 UPF0213 protein YPTB0498 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JLW2 1.32e-31 109 63 0 87 3 YPK_3712 UPF0213 protein YPK_3712 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CM36 1.44e-31 109 64 0 85 3 YPN_0612 UPF0213 protein YPN_0612 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5C3 1.44e-31 109 64 0 85 3 YpAngola_A4013 UPF0213 protein YpAngola_A4013 Yersinia pestis bv. Antiqua (strain Angola)
A7FMQ4 1.44e-31 109 64 0 85 3 YpsIP31758_3578 UPF0213 protein YpsIP31758_3578 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8ZBE1 1.44e-31 109 64 0 85 3 YPO3475 UPF0213 protein YPO3475/y0709/YP_0608 Yersinia pestis
A4TQT0 1.44e-31 109 64 0 85 3 YPDSF_3285 UPF0213 protein YPDSF_3285 Yersinia pestis (strain Pestoides F)
Q1C3N3 1.44e-31 109 64 0 85 3 YPA_2977 UPF0213 protein YPA_2977 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JIY7 2.52e-31 108 60 0 88 3 YE0453 UPF0213 protein YE0453 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D994 1.64e-29 104 54 0 93 3 ECA0725 UPF0213 protein ECA0725 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DKL5 3.33e-29 103 55 0 93 3 PC1_0597 UPF0213 protein PC1_0597 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7MZ08 4.58e-29 103 55 0 90 3 plu4503 UPF0213 protein plu4503 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P45472 2.05e-27 99 62 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain K12)
B1XGW7 2.05e-27 99 62 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain K12 / DH10B)
C4ZSP6 2.05e-27 99 62 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZS50 7.04e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NDD9 8.12e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R6I6 9.15e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain UTI89 / UPEC)
Q8FD94 9.15e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCV4 9.15e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG60 9.15e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O1:K1 / APEC
B7MB76 9.15e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LR08 9.25e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3YX86 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella sonnei (strain Ss046)
Q83JG5 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella flexneri
Q0T0C6 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella flexneri serotype 5b (strain 8401)
Q32BH8 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella dysenteriae serotype 1 (strain Sd197)
Q31W34 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella boydii serotype 4 (strain Sb227)
B2U2L2 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LFQ6 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain SMS-3-5 / SECEC)
B6I1N0 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain SE11)
A8A4X1 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O9:H4 (strain HS)
B7N0U0 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O81 (strain ED1a)
B7NKM4 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YS45 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA92 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O157:H7
B7LH93 9.46e-27 97 61 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli (strain 55989 / EAEC)
A8G925 1.02e-26 97 58 0 84 3 Spro_0507 UPF0213 protein Spro_0507 Serratia proteamaculans (strain 568)
A9MPN7 3.22e-26 96 58 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7UJ50 3.55e-26 96 60 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7M063 6.2e-26 95 60 0 78 3 yhbQ UPF0213 protein YhbQ Escherichia coli O8 (strain IAI1)
A4WEX0 8.71e-26 95 57 0 78 3 Ent638_3592 UPF0213 protein Ent638_3592 Enterobacter sp. (strain 638)
P67349 1.55e-25 94 56 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67350 1.55e-25 94 56 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella typhi
A9N717 1.55e-25 94 56 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLA5 1.55e-25 94 56 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57JJ4 1.55e-25 94 56 0 81 3 yhbQ UPF0213 protein YhbQ Salmonella choleraesuis (strain SC-B67)
A4Q8H2 4.48e-25 93 52 0 89 3 None UPF0213 protein in potE 3'region Serratia liquefaciens
A7MIP1 5.29e-25 93 58 0 79 3 ESA_03545 UPF0213 protein ESA_03545 Cronobacter sakazakii (strain ATCC BAA-894)
A8AQ40 7.65e-25 92 57 0 78 3 CKO_04549 UPF0213 protein CKO_04549 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TEH4 1.24e-24 92 54 0 82 3 KPN78578_35340 UPF0213 protein KPN78578_35340 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2NW13 3.92e-23 88 48 1 98 3 SG0387 UPF0213 protein SG0387 Sodalis glossinidius (strain morsitans)
A5EZS6 9.08e-22 85 48 1 86 3 VC0395_0675 UPF0213 protein VC0395_0675/VC395_A0575 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KLK4 3.75e-21 83 47 1 86 3 VC_A0739 UPF0213 protein VC_A0739 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7N3Z0 1.73e-19 79 50 0 78 3 VIBHAR_05350 UPF0213 protein VIBHAR_05350 Vibrio campbellii (strain ATCC BAA-1116)
A0KPI3 2.47e-19 79 48 1 80 3 AHA_3736 UPF0213 protein AHA_3736 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6AJN1 4.01e-19 78 45 1 82 3 DP2720 UPF0213 protein DP2720 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4SIJ4 9.45e-19 78 44 0 86 3 ASA_0550 UPF0213 protein ASA_0550 Aeromonas salmonicida (strain A449)
Q9KGL3 1.81e-16 71 40 1 96 1 BH0048 UPF0213 protein BH0048 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3ITQ4 5.19e-16 70 41 0 78 3 NP_0776A UPF0213 protein NP_0776A Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q87GU3 8.4e-16 70 44 0 76 3 VPA1222 UPF0213 protein VPA1222 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EU46 9.9e-16 69 39 0 81 3 OB0043 UPF0213 protein OB0043 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q46PN1 1.39e-15 68 41 1 87 3 Reut_B5558 UPF0213 protein Reut_B5558 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5HII9 1.85e-15 68 40 0 81 3 SACOL0530 UPF0213 protein SACOL0530 Staphylococcus aureus (strain COL)
Q6GJI3 1.85e-15 68 40 0 81 3 SAR0489 UPF0213 protein SAR0489 Staphylococcus aureus (strain MRSA252)
P67351 1.85e-15 68 40 0 81 3 SAV0488 UPF0213 protein SAV0488 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WYN2 1.85e-15 68 40 0 81 3 SAHV_0485 UPF0213 protein SAHV_0485 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2FJF4 1.85e-15 68 40 0 81 3 SAUSA300_0465 UPF0213 protein SAUSA300_0465 Staphylococcus aureus (strain USA300)
Q2G2W7 1.85e-15 68 40 0 81 3 SAOUHSC_00458 UPF0213 protein SAOUHSC_00458 Staphylococcus aureus (strain NCTC 8325 / PS 47)
P67352 1.85e-15 68 40 0 81 3 SA0446 UPF0213 protein SA0446 Staphylococcus aureus (strain N315)
Q6GC00 1.85e-15 68 40 0 81 3 SAS0445 UPF0213 protein SAS0445 Staphylococcus aureus (strain MSSA476)
P67353 1.85e-15 68 40 0 81 3 MW0443 UPF0213 protein MW0443 Staphylococcus aureus (strain MW2)
Q2YVV7 1.85e-15 68 40 0 81 3 SAB0437 UPF0213 protein SAB0437 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q49UZ7 2.49e-15 68 37 0 80 3 SSP2268 UPF0213 protein SSP2268 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q88P81 4.8e-15 68 41 0 78 3 PP_0972 UPF0213 protein PP_0972 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q91FT0 5.73e-15 67 38 1 94 4 IIV6-242L Putative GIY-YIG domain-containing protein 242L Invertebrate iridescent virus 6
Q8CQU1 7.47e-15 67 40 0 77 3 SE_2295 UPF0213 protein SE_2295 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRR7 7.47e-15 67 40 0 77 3 SERP0126 UPF0213 protein SERP0126 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O10332 7.47e-15 67 41 2 93 3 ORF82 UPF0213 protein ORF82 Orgyia pseudotsugata multicapsid polyhedrosis virus
Q4L3E5 1.15e-14 66 35 0 78 3 SH2523 UPF0213 protein SH2523 Staphylococcus haemolyticus (strain JCSC1435)
Q9HXF2 1.39e-14 67 39 0 81 3 PA3854 UPF0213 protein PA3854 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02S14 1.39e-14 67 39 0 81 3 PA14_14150 UPF0213 protein PA14_14150 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q06692 1.45e-14 66 39 3 97 3 None UPF0213 protein in VLF1-GP41 intergenic region Autographa californica nuclear polyhedrosis virus
Q9HN31 2.25e-14 65 43 0 73 3 VNG_2274C UPF0213 protein VNG_2274C Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
A8F902 2.37e-14 66 35 0 82 3 BPUM_0019 UPF0213 protein BPUM_0019 Bacillus pumilus (strain SAFR-032)
Q18E71 2.73e-14 65 40 0 77 3 HQ_3675A UPF0213 protein HQ_3675A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q038L1 3.08e-14 65 37 0 80 3 LSEI_1587 UPF0213 protein LSEI_1587 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A7Z0F8 3.83e-14 65 35 0 81 3 RBAM_000440 UPF0213 protein RBAM_000440 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0K4W7 7.75e-14 64 38 0 86 3 H16_B0156 UPF0213 protein H16_B0156 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A6V0Q7 1.02e-13 64 38 1 88 3 PSPA7_1257 UPF0213 protein PSPA7_1257 Pseudomonas aeruginosa (strain PA7)
Q725W6 4.04e-13 63 35 1 81 3 DVU_3309 UPF0213 protein DVU_3309 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q65PI6 1.9e-12 61 32 0 81 3 BLi00048 UPF0213 protein BLi00048/BL00536 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O31414 3.11e-12 60 32 0 81 3 yazA UPF0213 protein YazA Bacillus subtilis (strain 168)
Q73FH3 9.74e-12 59 36 1 85 3 BCE_0033 UPF0213 protein BCE_0033 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8XKF6 1.08e-11 59 34 0 78 3 CPE1444 UPF0213 protein CPE1444 Clostridium perfringens (strain 13 / Type A)
Q8P698 1.42e-11 58 36 0 73 3 XCC3072 UPF0213 protein XCC3072 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UXR7 1.42e-11 58 36 0 73 3 XC_1086 UPF0213 protein XC_1086 Xanthomonas campestris pv. campestris (strain 8004)
Q38W63 1.93e-11 58 36 0 79 3 LCA_1266 UPF0213 protein LCA_1266 Latilactobacillus sakei subsp. sakei (strain 23K)
Q3K1S8 3.55e-11 57 39 0 71 3 SAK_0903 UPF0213 protein SAK_0903 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8E629 3.55e-11 57 39 0 71 3 gbs0798 UPF0213 protein gbs0798 Streptococcus agalactiae serotype III (strain NEM316)
Q8E0F5 3.55e-11 57 39 0 71 3 SAG0778 UPF0213 protein SAG0778 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8PHP7 8.19e-11 57 33 0 81 3 XAC3202 UPF0213 protein XAC3202 Xanthomonas axonopodis pv. citri (strain 306)
Q81W06 1.3e-10 56 35 0 77 3 BA_0032 UPF0213 protein BA_0032/GBAA_0032/BAS0034 Bacillus anthracis
Q6HPY1 1.3e-10 56 35 0 77 3 BT9727_0031 UPF0213 protein BT9727_0031 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HH3 1.3e-10 56 35 0 77 3 BCE33L0031 UPF0213 protein BCE33L0031 Bacillus cereus (strain ZK / E33L)
A3CLU1 1.83e-10 55 37 0 75 3 SSA_0709 UPF0213 protein SSA_0709 Streptococcus sanguinis (strain SK36)
Q97PR7 3.9e-10 55 32 1 87 1 SP_1535 UPF0213 protein SP_1535 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2P644 3.91e-10 55 32 0 87 3 XOO1228 UPF0213 protein XOO1228 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8DP31 5.21e-10 55 32 1 87 3 spr1390 UPF0213 protein spr1390 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JL4 5.21e-10 55 32 1 87 3 SPD_1364 UPF0213 protein SPD_1364 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q88VJ1 7.53e-10 54 35 1 79 3 lp_2058 UPF0213 protein lp_2058 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A5VJC3 1.01e-09 54 32 2 92 3 Lreu_0682 UPF0213 protein Lreu_0682 Limosilactobacillus reuteri (strain DSM 20016)
Q9JSU8 1.88e-09 53 35 0 79 3 NMA2126 UPF0213 protein NMA2126 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q03FT8 3.24e-09 52 29 0 87 3 PEPE_0875 UPF0213 protein PEPE_0875 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P95364 4.09e-09 52 35 0 79 3 None UPF0213 protein in glnA 3'region Neisseria gonorrhoeae
Q5F6G1 4.09e-09 52 35 0 79 3 NGO1598 UPF0213 protein NGO1598 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q02X30 7.29e-09 52 32 1 82 3 LACR_2011 UPF0213 protein LACR_2011 Lactococcus lactis subsp. cremoris (strain SK11)
A2RMP4 7.29e-09 52 32 1 82 3 llmg_2010 UPF0213 protein llmg_2010 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9K132 1.02e-08 51 34 0 79 3 NMB0361 UPF0213 protein NMB0361 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KVS3 1.02e-08 51 34 0 79 3 NMC1807 UPF0213 protein NMC1807 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q51440 2.76e-08 50 29 1 94 3 None UPF0213 protein in ldhD 5'region Pediococcus acidilactici
Q9CEL6 1.15e-07 48 32 1 81 3 ysiG UPF0213 protein YsiG Lactococcus lactis subsp. lactis (strain IL1403)
Q92F97 2.08e-07 48 28 0 84 3 lin0209 UPF0213 protein lin0209 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AEY3 2.96e-07 47 28 0 84 3 lwe0147 UPF0213 protein lwe0147 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A2RDW6 1.15e-06 46 32 1 73 3 SpyM50708 UPF0213 protein SpyM50708 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8P0C9 1.15e-06 46 32 1 73 3 spyM18_1420 UPF0213 protein spyM18_1420 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1JG57 1.15e-06 46 32 1 73 3 MGAS10270_Spy1222 UPF0213 protein MGAS10270_Spy1222 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XBA0 1.15e-06 46 32 1 73 3 M6_Spy1178 UPF0213 protein M6_Spy1178 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q48SQ4 1.15e-06 46 32 1 73 3 M28_Spy1146 UPF0213 protein M28_Spy1146 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q830S9 1.48e-06 45 30 1 82 1 EF_2693 UPF0213 protein EF_2693 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2LS66 2.06e-06 45 28 1 83 3 SYNAS_10430 UPF0213 protein SYNAS_10430 Syntrophus aciditrophicus (strain SB)
P67354 2.13e-06 45 32 1 73 3 SPy_1412 UPF0213 protein SPy_1412/M5005_Spy1151 Streptococcus pyogenes serotype M1
Q1J5X5 2.13e-06 45 32 1 73 3 MGAS10750_Spy1258 UPF0213 protein MGAS10750_Spy1258 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JAY8 2.13e-06 45 32 1 73 3 MGAS2096_Spy1218 UPF0213 protein MGAS2096_Spy1218 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q1JL34 2.13e-06 45 32 1 73 3 MGAS9429_Spy1198 UPF0213 protein MGAS9429_Spy1198 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0DG93 2.13e-06 45 32 1 73 3 SPs0786 UPF0213 protein SPs0786 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG92 2.13e-06 45 32 1 73 3 SpyM3_1077 UPF0213 protein SpyM3_1077 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8RIL3 3.48e-06 45 35 0 62 3 FN1575 UPF0213 protein FN1575 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q724P3 1.9e-05 43 30 0 72 3 LMOf2365_0181 UPF0213 protein LMOf2365_0181 Listeria monocytogenes serotype 4b (strain F2365)
Q8YAG0 2.07e-05 42 30 0 72 3 lmo0166 UPF0213 protein lmo0166 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12760
Feature type CDS
Gene yhbQ
Product putative endonuclease, GIY-YIG superfamily
Location 29151 - 29471 (strand: 1)
Length 321 (nucleotides) / 106 (amino acids)

Contig

Accession ZDB_222
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1419
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01541 GIY-YIG catalytic domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2827 Replication, recombination and repair (L) L Predicted endonuclease, GIY-YIG superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07461 putative endonuclease - -

Protein Sequence

MTIASDKNTWFLYIIRTESGYLYTGITRDVALRVATHQSGKGAKYLRGKTGLQVVYQAALADRSIASKEEYRVKQLTKQKKERLVSDQPSDLTTYLNGGDYSQLSK

Flanking regions ( +/- flanking 50bp)

ACAAAATATTCGCCTTTCATACAAACATAAAAAGGCACGATTAAGCAAAAATGACGATAGCATCAGACAAAAATACGTGGTTCCTTTACATAATCAGGACAGAATCCGGATATCTTTACACAGGGATCACCCGTGATGTCGCACTGCGCGTTGCGACACATCAGTCCGGAAAGGGTGCGAAATATCTGCGGGGGAAAACAGGGTTGCAAGTGGTATATCAGGCCGCTCTGGCGGATCGTTCAATCGCGTCAAAAGAAGAATACCGGGTCAAGCAACTGACAAAACAGAAAAAAGAAAGGCTGGTCAGTGACCAGCCCTCCGATTTGACGACATACCTTAACGGTGGTGATTATTCACAGCTGTCAAAATGATGTGAGAAATTAACCAGCCCGTGATAACGGTCTGCGGCATCATTTTCCAG