Homologs in group_191

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08800 FBDBKF_08800 100.0 Morganella morganii S1 ridA 2-iminobutanoate/2-iminopropanoate deaminase
NLDBIP_13065 NLDBIP_13065 100.0 Morganella morganii S4 ridA 2-iminobutanoate/2-iminopropanoate deaminase
LHKJJB_13490 LHKJJB_13490 100.0 Morganella morganii S3 ridA 2-iminobutanoate/2-iminopropanoate deaminase
HKOGLL_11540 HKOGLL_11540 100.0 Morganella morganii S5 ridA 2-iminobutanoate/2-iminopropanoate deaminase
F4V73_RS10020 F4V73_RS10020 89.8 Morganella psychrotolerans ridA 2-iminobutanoate/2-iminopropanoate deaminase
PMI_RS05960 PMI_RS05960 30.9 Proteus mirabilis HI4320 - RidA family protein
PMI_RS17070 PMI_RS17070 52.4 Proteus mirabilis HI4320 - RidA family protein
PMI_RS17210 PMI_RS17210 72.4 Proteus mirabilis HI4320 - RidA family protein

Distribution of the homologs in the orthogroup group_191

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_191

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CP78 5.65e-76 224 84 0 128 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AF95 2.14e-73 217 82 0 128 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Shigella flexneri
P0AF93 2.14e-73 217 82 0 128 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli (strain K12)
P0AF94 2.14e-73 217 82 0 128 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9L6B5 2.74e-66 199 77 1 128 3 PM1466 RutC family protein PM1466 Pasteurella multocida (strain Pm70)
P44839 5.4e-65 196 76 1 129 1 HI_0719 RutC family protein HI_0719 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AGL4 1.11e-61 187 70 0 127 3 tdcF Putative reactive intermediate deaminase TdcF Shigella flexneri
P0AGL2 1.11e-61 187 70 0 127 1 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli (strain K12)
P0AGL3 1.11e-61 187 70 0 127 3 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8U308 1.83e-47 151 58 2 129 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O58584 7.31e-46 147 57 2 129 1 PH0854 RutC family protein PH0854 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UZA3 1.09e-42 139 53 2 127 3 PYRAB12510 RutC family protein PYRAB12510 Pyrococcus abyssi (strain GE5 / Orsay)
P37552 2.11e-42 139 52 1 128 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Bacillus subtilis (strain 168)
P52761 1.2e-39 132 52 2 126 3 slr0709 RutC family protein slr0709 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P57452 1.04e-36 124 45 0 128 3 BU371 RutC family protein BU371 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K9H7 3.18e-36 123 43 0 128 3 BUsg_359 RutC family protein BUsg_359 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O25598 1.26e-35 122 47 2 128 3 HP_0944 RutC family protein HP_0944 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKQ6 1.33e-35 121 47 2 128 3 jhp_0879 RutC family protein jhp_0879 Helicobacter pylori (strain J99 / ATCC 700824)
P55654 1.08e-33 117 46 2 125 3 NGR_a01620 RutC family protein y4sK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q973T6 1.12e-32 114 45 2 124 1 STK_08110 RutC family protein STK_08110 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q89AG0 1.67e-32 114 43 1 127 3 bbp_334 RutC family protein bbp_334 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O34133 2.82e-32 113 47 2 124 3 aldR Putative regulator AldR Lactococcus lactis subsp. lactis (strain IL1403)
Q97U19 5.25e-32 112 45 2 126 3 SSO3206 RutC family protein SSO3206 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q10121 6.66e-32 114 45 1 124 3 C23G10.2 RutC family protein C23G10.2 Caenorhabditis elegans
P52758 1.88e-31 111 46 2 126 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Homo sapiens
Q3T114 4.17e-31 110 46 2 126 2 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Bos taurus
P52759 7.93e-31 110 47 2 126 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Rattus norvegicus
O52178 9.79e-31 109 47 3 127 3 dfrA Protein DfrA Myxococcus xanthus
P52760 1.04e-30 109 45 2 128 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Mus musculus
A0A1J1DL12 6.12e-30 107 42 2 125 1 MAG133 2-iminobutanoate/2-iminopropanoate deaminase Dermatophagoides farinae
P80601 1.28e-29 107 45 2 126 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Capra hircus
P97117 1.08e-28 104 46 2 127 3 None RutC family protein in leuC 5'region Leuconostoc mesenteroides subsp. cremoris
Q94JQ4 2.47e-27 102 45 2 124 1 RIDA Reactive Intermediate Deaminase A, chloroplastic Arabidopsis thaliana
O66689 8.59e-27 99 40 1 123 3 aq_364 RutC family protein aq_364 Aquifex aeolicus (strain VF5)
P40185 1.64e-26 99 42 1 124 1 MMF1 Protein MMF1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P40431 3.36e-25 95 42 3 128 3 None RutC family protein in vnfA 5'region Azotobacter vinelandii
Q9V3W0 7.94e-23 89 41 2 125 2 UK114 RutC family protein UK114 Drosophila melanogaster
P40037 9.45e-23 89 41 1 106 1 HMF1 Protein HMF1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6FFZ5 4.1e-19 79 34 2 124 3 rutC 3-aminoacrylate deaminase RutC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O43003 4.54e-19 80 40 5 124 3 mmf1 Protein mmf1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A6T7A0 2.92e-16 72 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
D3RKL2 5.22e-16 72 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Klebsiella variicola (strain At-22)
B5XXN2 5.28e-16 72 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae (strain 342)
B1M5I6 7.41e-16 71 34 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
D3QPK3 2.02e-15 70 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O55:H7 (strain CB9615 / EPEC)
Q8XAU5 2.02e-15 70 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O157:H7
Q32HQ1 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RDK7 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain UTI89 / UPEC)
B1LIZ5 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SMS-3-5 / SECEC)
D2NGI7 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O150:H5 (strain SE15)
P0AFQ5 4.43e-15 69 33 2 124 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12)
B1IV87 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AFQ6 4.43e-15 69 33 2 124 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ57 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
D5CZH0 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
A1A9R5 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O1:K1 / APEC
A7ZYW5 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O9:H4 (strain HS)
B1X9D1 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / DH10B)
C9QZ66 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD8 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / MC4100 / BW2952)
C6UFC1 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / REL606)
C6EHJ7 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / BL21-DE3)
B7M8Z5 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O8 (strain IAI1)
B7MTF3 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O81 (strain ED1a)
B7NLB6 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MIF7 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O45:K1 (strain S88 / ExPEC)
D3H123 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O44:H18 (strain 042 / EAEC)
B7UNZ3 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKB5 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O139:H28 (strain E24377A / ETEC)
C8U5H2 4.43e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O103:H2 (strain 12009 / EHEC)
D5CE34 6.11e-15 69 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
C5B0U7 6.2e-15 69 32 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
B6I986 7.5e-15 68 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SE11)
A9W3H9 8.2e-15 68 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain PA1)
C7CM34 8.2e-15 68 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
B7KWT5 8.2e-15 68 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B7N3G6 1.06e-14 68 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1ZB17 1.06e-14 68 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B7LFC0 1.4e-14 68 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain 55989 / EAEC)
C8TNC0 1.4e-14 68 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM6 1.4e-14 68 33 2 124 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O111:H- (strain 11128 / EHEC)
A4W923 1.46e-14 68 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Enterobacter sp. (strain 638)
C9Y0S5 1.92e-14 68 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
C5CN81 5.61e-14 66 35 2 113 3 rutC 3-aminoacrylate deaminase RutC Variovorax paradoxus (strain S110)
A7ME54 7.2e-14 66 31 2 124 3 rutC 3-aminoacrylate deaminase RutC Cronobacter sakazakii (strain ATCC BAA-894)
A8IAD2 1.24e-13 65 28 2 128 3 rutC 3-aminoacrylate deaminase RutC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9UR06 1.3e-13 65 33 4 129 3 mmf2 Protein mmf2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q83LK7 3.08e-13 64 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri
Q0T624 3.08e-13 64 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype 5b (strain 8401)
D2AC41 3.08e-13 64 32 2 124 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype X (strain 2002017)
D4GEU6 3.18e-13 64 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Pantoea ananatis (strain LMG 20103)
D0LI57 4.39e-13 64 33 3 125 3 rutC 3-aminoacrylate deaminase RutC Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
Q48MQ6 7.02e-13 63 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7CWX2 7.49e-13 63 30 2 124 3 rutC 3-aminoacrylate deaminase RutC Agrobacterium fabrum (strain C58 / ATCC 33970)
A4VQH6 1.02e-12 63 33 3 120 3 rutC 3-aminoacrylate deaminase RutC Stutzerimonas stutzeri (strain A1501)
Q4ZXR9 1.27e-12 63 31 2 113 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas syringae pv. syringae (strain B728a)
B9JLT7 1.82e-12 62 33 2 113 3 rutC 3-aminoacrylate deaminase RutC Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B0SW61 2.6e-12 62 30 2 123 3 rutC 3-aminoacrylate deaminase RutC Caulobacter sp. (strain K31)
A8GCT4 4.67e-12 61 30 2 113 3 rutC 3-aminoacrylate deaminase RutC Serratia proteamaculans (strain 568)
Q9KWS2 1.9e-11 60 31 4 134 1 amnD 2-aminomuconate deaminase Pseudomonas sp.
D5VGV2 2.69e-11 59 30 2 123 3 rutC 3-aminoacrylate deaminase RutC Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
A1JMX4 2.81e-11 59 27 2 123 3 rutC 3-aminoacrylate deaminase RutC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P0AEB9 0.000159 41 30 1 81 3 yoaB RutC family protein YoaB Shigella flexneri
P0AEB7 0.000159 41 30 1 81 3 yoaB RutC family protein YoaB Escherichia coli (strain K12)
P0AEB8 0.000159 41 30 1 81 3 yoaB RutC family protein YoaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12725
Feature type CDS
Gene ridA
Product 2-iminobutanoate/2-iminopropanoate deaminase
Location 22816 - 23202 (strand: 1)
Length 387 (nucleotides) / 128 (amino acids)

Contig

Accession ZDB_222
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_191
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01042 Endoribonuclease L-PSP

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0251 Defense mechanisms (V) V Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09022 2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10] - -

Protein Sequence

MTKVIATENAPAAIGPYVQAVDLGNMVMTSGQIPVDPKTGAVADDVKAQARQSLNNIKAIIEQAGLKVTDIVKTTVFVKDLNDFATVNAEYAAFFDEHKAVYPARSCVEVARLPKDVKLEIEAIAVRK

Flanking regions ( +/- flanking 50bp)

ATGGCGTTTTTAAAAGCTTAACAGCAATAATCATCCTACAGGAGTCCGTAATGACTAAAGTAATCGCAACAGAAAACGCACCAGCAGCAATCGGCCCGTATGTACAGGCAGTAGACCTGGGTAACATGGTAATGACTTCAGGTCAGATCCCTGTTGATCCGAAAACCGGTGCAGTTGCTGACGATGTTAAAGCTCAGGCACGCCAGTCACTGAACAACATCAAAGCTATCATCGAACAGGCTGGTCTGAAAGTTACGGATATCGTGAAAACAACTGTTTTCGTTAAAGATCTGAACGACTTTGCTACTGTGAACGCAGAATACGCTGCTTTCTTTGATGAGCACAAAGCAGTATACCCTGCACGTTCTTGCGTTGAAGTTGCGCGTCTGCCAAAAGACGTTAAATTAGAAATCGAAGCAATCGCAGTCCGTAAATAATCACTGCGCTTTCTGAGAGTGATAATGAAAACCCTGCAAGGTGCGGGGTT