Homologs in group_1003

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05085 FBDBKF_05085 100.0 Morganella morganii S1 yciS DUF1049 domain-containing protein
NLDBIP_12845 NLDBIP_12845 100.0 Morganella morganii S4 yciS DUF1049 domain-containing protein
LHKJJB_12705 LHKJJB_12705 100.0 Morganella morganii S3 yciS DUF1049 domain-containing protein
HKOGLL_11320 HKOGLL_11320 100.0 Morganella morganii S5 yciS DUF1049 domain-containing protein
F4V73_RS05540 F4V73_RS05540 94.1 Morganella psychrotolerans - LapA family protein
PMI_RS06345 PMI_RS06345 67.7 Proteus mirabilis HI4320 - lipopolysaccharide assembly protein LapA domain-containing protein

Distribution of the homologs in the orthogroup group_1003

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1003

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACV5 9.43e-40 130 59 0 101 3 lapA Lipopolysaccharide assembly protein A Shigella flexneri
P0ACV4 9.43e-40 130 59 0 101 1 lapA Lipopolysaccharide assembly protein A Escherichia coli (strain K12)
P44129 2.2e-23 89 40 3 98 3 lapA Probable lipopolysaccharide assembly protein A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12505
Feature type CDS
Gene yciS
Product DUF1049 domain-containing protein
Location 158768 - 159073 (strand: 1)
Length 306 (nucleotides) / 101 (amino acids)
In genomic island -

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1003
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06305 Lipopolysaccharide assembly protein A domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3771 Function unknown (S) S Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08992 lipopolysaccharide assembly protein A - -

Protein Sequence

MKYFLIFILVLVVFIISVTLGANNDQVVTFNYLIAQGQYSVSTLLAVLFGIGFVLGWIVCGLFYLRLRLSLARARHRIKRLEADQTVQSSASVALRDTTKE

Flanking regions ( +/- flanking 50bp)

GCGTCTGCAAGAAGCAGGCGCGGAATGCAAGCCTGATAATAGGAACGCCGGTGAAATATTTTCTGATTTTTATCCTTGTACTGGTGGTTTTCATCATTTCGGTGACACTGGGCGCAAATAACGATCAGGTAGTCACATTTAATTATCTGATTGCGCAGGGACAGTATTCTGTATCCACCTTGCTGGCCGTACTGTTCGGTATCGGTTTTGTGCTGGGCTGGATTGTCTGCGGTCTGTTTTATTTACGTCTGCGGTTGTCGCTGGCCCGTGCCCGGCACCGGATCAAACGTCTGGAAGCTGACCAGACGGTGCAGTCTTCCGCTTCGGTTGCACTGCGGGACACCACTAAGGAATAAGCATTATGCTTGAGCTGTTGTTTCTTCTGTTGCCCATTGCTGCCGCATAC