Homologs in group_1018

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05185 FBDBKF_05185 100.0 Morganella morganii S1 osmY Osmotically-inducible protein OsmY, contains BON domain
NLDBIP_12745 NLDBIP_12745 100.0 Morganella morganii S4 osmY Osmotically-inducible protein OsmY, contains BON domain
LHKJJB_12605 LHKJJB_12605 100.0 Morganella morganii S3 osmY Osmotically-inducible protein OsmY, contains BON domain
HKOGLL_11220 HKOGLL_11220 100.0 Morganella morganii S5 osmY Osmotically-inducible protein OsmY, contains BON domain
F4V73_RS05640 F4V73_RS05640 95.2 Morganella psychrotolerans - BON domain-containing protein
PMI_RS06510 PMI_RS06510 72.1 Proteus mirabilis HI4320 - BON domain-containing protein

Distribution of the homologs in the orthogroup group_1018

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1018

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFH8 2.08e-12 63 48 0 72 1 osmY Osmotically-inducible protein Y Escherichia coli (strain K12)
P0AFH8 1.25e-08 53 39 0 71 1 osmY Osmotically-inducible protein Y Escherichia coli (strain K12)
P0AFH9 2.08e-12 63 48 0 72 3 osmY Osmotically-inducible protein Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH9 1.25e-08 53 39 0 71 3 osmY Osmotically-inducible protein Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P35664 5.27e-07 48 37 0 67 4 None Uncharacterized protein in gshII 5'region (Fragment) Anaplasma centrale
P64596 8.3e-06 45 43 1 67 1 dolP Outer membrane lipoprotein DolP Escherichia coli (strain K12)
P64597 8.3e-06 45 43 1 67 3 dolP Outer membrane lipoprotein DolP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64598 8.3e-06 45 43 1 67 3 dolP Outer membrane lipoprotein DolP Escherichia coli O157:H7
Q7CPQ6 2.36e-05 44 41 1 67 2 dolP Outer membrane lipoprotein DolP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12405
Feature type CDS
Gene osmY
Product Osmotically-inducible protein OsmY, contains BON domain
Location 136095 - 136409 (strand: -1)
Length 315 (nucleotides) / 104 (amino acids)
In genomic island -

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1018
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04972 BON domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2823 Cell wall/membrane/envelope biogenesis (M) M Osmotically-inducible protein OsmY, contains BON domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04065 hyperosmotically inducible periplasmic protein - -

Protein Sequence

MKYMKLVTSFFVVMFMAFTLSACAPTATSEGTGGYFDDSVITTKVKTALLGEKGIKSTQISVETFKGKVQLSGFVSSEKEANLAVNTARKVPGVKVVINSMKLR

Flanking regions ( +/- flanking 50bp)

GGTCAGGCACACATTATTCTGCGATCCGTGCCGGTAATAAGGAGAACATAATGAAGTATATGAAACTGGTCACCTCATTTTTTGTTGTCATGTTTATGGCTTTCACCCTGTCCGCCTGTGCCCCGACTGCCACCAGTGAAGGTACCGGGGGGTATTTTGATGATTCCGTCATTACCACTAAAGTGAAAACAGCGTTACTGGGTGAGAAAGGCATTAAATCCACTCAAATCAGCGTGGAAACATTTAAAGGTAAAGTTCAGCTGAGCGGATTTGTCTCTTCAGAAAAAGAAGCGAACCTGGCGGTAAATACCGCGCGTAAAGTTCCGGGTGTGAAGGTTGTTATTAACTCAATGAAGTTGCGGTGACTCTGAATATCAGATTACCGGATAAAAAAACGGCGCAATAAGAATTGCGC