Homologs in group_1074

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06090 FBDBKF_06090 100.0 Morganella morganii S1 ygdD DUF423 domain-containing protein
NLDBIP_09515 NLDBIP_09515 100.0 Morganella morganii S4 ygdD DUF423 domain-containing protein
LHKJJB_08240 LHKJJB_08240 100.0 Morganella morganii S3 ygdD DUF423 domain-containing protein
HKOGLL_07790 HKOGLL_07790 100.0 Morganella morganii S5 ygdD DUF423 domain-containing protein
F4V73_RS15820 F4V73_RS15820 96.2 Morganella psychrotolerans - DUF423 domain-containing protein
PMI_RS11360 PMI_RS11360 62.6 Proteus mirabilis HI4320 - DUF423 domain-containing protein

Distribution of the homologs in the orthogroup group_1074

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1074

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADR5 1.34e-46 150 52 0 131 3 ygdD UPF0382 inner membrane protein YgdD Shigella flexneri
P0ADR2 1.34e-46 150 52 0 131 1 ygdD UPF0382 inner membrane protein YgdD Escherichia coli (strain K12)
P0ADR3 1.34e-46 150 52 0 131 3 ygdD UPF0382 inner membrane protein YgdD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADR4 1.34e-46 150 52 0 131 3 ygdD UPF0382 inner membrane protein YgdD Escherichia coli O157:H7
P45019 1.79e-18 78 35 2 127 3 HI_1073 UPF0382 membrane protein HI_1073 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2YS64 4.14e-13 64 31 1 119 3 SAB0533 UPF0382 membrane protein SAB0533 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5HI93 5.19e-13 64 31 1 119 3 SACOL0629 UPF0382 membrane protein SACOL0629 Staphylococcus aureus (strain COL)
Q6GJ86 5.19e-13 64 31 1 119 3 SAR0588 UPF0382 membrane protein SAR0588 Staphylococcus aureus (strain MRSA252)
Q99W28 5.19e-13 64 31 1 119 3 SAV0583 UPF0382 membrane protein SAV0583 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2G0J5 5.19e-13 64 31 1 119 3 SAOUHSC_00567 UPF0382 membrane protein SAOUHSC_00567 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ60 5.19e-13 64 31 1 119 3 SAUSA300_0565 UPF0382 membrane protein SAUSA300_0565 Staphylococcus aureus (strain USA300)
Q6GBQ4 5.19e-13 64 31 1 119 3 SAS0541 UPF0382 membrane protein SAS0541 Staphylococcus aureus (strain MSSA476)
Q7A763 5.19e-13 64 31 1 119 3 SA0540 UPF0382 membrane protein SA0540 Staphylococcus aureus (strain N315)
Q7A1P4 5.19e-13 64 31 1 119 3 MW0538 UPF0382 membrane protein MW0538 Staphylococcus aureus (strain MW2)
Q8CTQ5 6.71e-12 61 35 3 121 3 SE_0353 UPF0382 membrane protein SE_0353 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRG3 1.36e-11 60 35 3 121 3 SERP0230 UPF0382 membrane protein SERP0230 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49VD3 1.45e-11 60 30 1 120 3 SSP2132 UPF0382 membrane protein SSP2132 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L3Q9 3.87e-11 59 30 1 119 3 SH2409 UPF0382 membrane protein SH2409 Staphylococcus haemolyticus (strain JCSC1435)
P39619 2.16e-09 54 28 2 121 2 ywdK UPF0382 membrane protein YwdK Bacillus subtilis (strain 168)
Q568J8 4.86e-07 48 32 4 115 3 tmem256 Transmembrane protein 256 Danio rerio
Q9P7G8 4.28e-06 46 32 3 115 3 SPAC1782.12c UPF0382 membrane protein C1782.12c Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09135
Feature type CDS
Gene ygdD
Product DUF423 domain-containing protein
Location 43207 - 43602 (strand: -1)
Length 396 (nucleotides) / 131 (amino acids)

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1074
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04241 Protein of unknown function (DUF423)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2363 Function unknown (S) S Uncharacterized membrane protein YgdD, TMEM256/DUF423 family

Protein Sequence

MNSRLMLIFAGFSGFFYVAFGAIGSHLLTPVLAKHQMDWINLGLQYQISHTLALMGLAAVLMRKVVLWFYWSGLFFGIGILLFSGSLYCMALLQMKYFAYFTPVGGVSFLLGWFCVLIGALRLRKVASGHE

Flanking regions ( +/- flanking 50bp)

TGGATGACAAGTGAGCAGGATTAACCTGAACTTCACATAAGGTATGGCAAATGAATAGTCGGTTGATGTTAATTTTTGCCGGTTTCAGCGGCTTTTTTTATGTTGCATTCGGCGCAATCGGATCGCACCTTTTAACACCGGTTCTGGCAAAGCACCAGATGGACTGGATTAATCTGGGTCTCCAGTACCAGATCTCACATACACTTGCCCTGATGGGGCTGGCCGCTGTGCTGATGCGCAAAGTGGTATTGTGGTTTTACTGGAGCGGACTGTTTTTCGGGATCGGCATTCTGCTGTTTTCCGGCAGCCTGTATTGTATGGCGCTGTTACAGATGAAATATTTTGCCTATTTTACGCCGGTTGGCGGGGTAAGTTTCCTGTTAGGCTGGTTTTGTGTATTGATTGGCGCGCTGCGTCTAAGGAAAGTGGCTTCCGGCCATGAATAAAATAGCATTATATTGCCGTCCGGGTTTTGAAAAAGAGTGTGCAGCTGAGA