Homologs in group_1040

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05880 FBDBKF_05880 100.0 Morganella morganii S1 gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
NLDBIP_09305 NLDBIP_09305 100.0 Morganella morganii S4 gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
LHKJJB_08450 LHKJJB_08450 100.0 Morganella morganii S3 gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
HKOGLL_08000 HKOGLL_08000 100.0 Morganella morganii S5 gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
F4V73_RS16015 F4V73_RS16015 90.8 Morganella psychrotolerans gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
PMI_RS11150 PMI_RS11150 66.7 Proteus mirabilis HI4320 gmhB D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase

Distribution of the homologs in the orthogroup group_1040

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1040

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8M1 1.05e-100 291 69 0 185 3 gmhB1 D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z989 1.94e-100 291 72 0 184 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Salmonella typhi
Q8ZRM8 2.75e-100 290 72 0 184 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63230 6.8e-100 289 70 0 188 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Shigella flexneri
P63228 6.8e-100 289 70 0 188 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Escherichia coli (strain K12)
P63229 6.8e-100 289 70 0 188 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Escherichia coli O157:H7
Q8FKZ1 1.99e-99 288 70 0 187 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZH37 1.71e-97 283 69 0 184 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Yersinia pestis
Q9CK98 3.83e-91 267 66 1 181 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Pasteurella multocida (strain Pm70)
P46452 4.94e-84 249 62 1 182 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KTJ4 3.12e-81 242 61 0 186 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7VL21 5.29e-77 231 61 2 178 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MY63 2.87e-53 171 43 1 180 3 gmhB2 D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9AI34 1.11e-48 159 44 1 179 3 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Burkholderia mallei (strain ATCC 23344)
Q9AGY5 4.09e-48 157 40 1 181 1 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Aneurinibacillus thermoaerophilus
Q97EQ5 5.9e-44 147 44 1 152 3 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9ZKY8 1.5e-41 140 44 3 156 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Helicobacter pylori (strain J99 / ATCC 700824)
O25531 3.05e-41 140 44 2 150 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Helicobacter pylori (strain ATCC 700392 / 26695)
Q6TG07 1.13e-40 138 43 2 158 1 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6N2R1 4.5e-38 132 41 0 144 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q97B60 4.53e-34 120 42 1 131 3 gmhB Probable D-glycero-D-manno-heptose-1,7-bisphosphate 7-phosphatase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HKQ2 7.81e-31 113 37 2 146 3 gmhB Probable D-glycero-D-manno-heptose-1,7-bisphosphate 7-phosphatase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8KAY7 1.34e-29 111 38 3 157 3 gmhB D-glycero-D-manno-heptose-1,7-bisphosphate 7-phosphatase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q98I56 1.08e-27 106 39 0 151 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9I7C0 1.16e-27 105 37 3 155 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DH26 2.66e-25 100 39 5 161 3 gmhB D-glycero-D-manno-heptose-1,7-bisphosphate 7-phosphatase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9JWE9 1.39e-23 95 35 3 153 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXI5 1.52e-23 95 35 3 153 3 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q88RS0 1.58e-23 94 34 4 154 1 gmhB D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7WG29 1.71e-22 92 33 4 154 1 BB4091 D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7U2U1 5.71e-19 83 33 3 137 3 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMV3 1.71e-18 82 33 3 137 3 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMV2 1.71e-18 82 33 3 137 3 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7VQW8 5.06e-17 80 32 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Blochmanniella floridana
P59454 8.27e-15 74 29 7 178 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q47XB6 1.46e-14 73 29 5 147 3 hisB Histidine biosynthesis bifunctional protein HisB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7N6I2 2.39e-14 73 30 5 145 3 hisB Histidine biosynthesis bifunctional protein HisB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7H5U9 7.05e-14 72 29 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FNR1 8.41e-14 71 30 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9PM76 8.58e-14 71 29 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5WX93 1.11e-13 71 30 3 133 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Lens)
Q5HSJ2 1.17e-13 71 29 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni (strain RM1221)
A1W1K1 1.37e-13 71 29 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q7MLS4 1.55e-13 71 27 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain YJ016)
Q8D8Q2 1.56e-13 71 27 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio vulnificus (strain CMCP6)
Q87QK9 1.74e-13 70 29 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8ZFX7 1.76e-13 70 29 3 137 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pestis
Q5ZW89 2.03e-13 70 30 3 133 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X5X1 2.07e-13 70 30 3 133 3 hisB Histidine biosynthesis bifunctional protein HisB Legionella pneumophila (strain Paris)
A6TBC5 2.65e-13 70 29 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D409 4.76e-13 69 27 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9S5G5 1.05e-12 68 28 2 142 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O157:H7
P06987 1.1e-12 68 28 2 142 1 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli (strain K12)
Q83R05 1.13e-12 68 28 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Shigella flexneri
Q66C51 1.37e-12 68 29 3 137 3 hisB Histidine biosynthesis bifunctional protein HisB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8FG50 1.47e-12 68 28 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
D2QPE6 1.71e-12 68 33 5 139 1 hisB Histidine biosynthesis bifunctional protein HisB Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896 / Claus 1)
Q8AAI7 1.88e-12 65 28 4 155 1 gmhB D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B3GZG9 1.93e-12 68 29 5 145 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65RB3 2.08e-12 67 30 5 142 3 hisB Histidine biosynthesis bifunctional protein HisB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8EFB3 2.41e-12 67 28 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2NTX3 2.61e-12 67 29 4 155 3 hisB Histidine biosynthesis bifunctional protein HisB Sodalis glossinidius (strain morsitans)
B0BU51 2.99e-12 67 29 5 145 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3W1 3.28e-12 67 28 5 145 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P57920 3.32e-12 67 30 5 140 3 hisB Histidine biosynthesis bifunctional protein HisB Pasteurella multocida (strain Pm70)
Q9KSX1 3.41e-12 67 27 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B8D708 4.16e-12 67 31 4 140 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57203 4.16e-12 67 31 4 140 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8Q4 4.16e-12 67 31 4 140 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q15RU7 4.58e-12 67 28 4 138 3 hisB Histidine biosynthesis bifunctional protein HisB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P62455 9e-12 66 27 2 137 3 hisB Histidine biosynthesis bifunctional protein HisB Photobacterium profundum (strain SS9)
Q9ZHE4 2.17e-11 65 28 3 148 3 hisB Histidine biosynthesis bifunctional protein HisB Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8Z5J8 2.37e-11 64 27 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhi
P10368 2.73e-11 64 27 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PDP5 2.73e-11 64 27 2 142 3 hisB Histidine biosynthesis bifunctional protein HisB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6VM11 4.24e-11 64 29 5 140 3 hisB Histidine biosynthesis bifunctional protein HisB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A5UGY3 6.44e-11 63 27 2 138 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittGG)
A5UA18 6.44e-11 63 27 2 138 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain PittEE)
Q4QN72 2.4e-10 62 26 2 138 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain 86-028NP)
P44327 3.45e-10 61 26 2 138 3 hisB Histidine biosynthesis bifunctional protein HisB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1LT69 4.99e-10 60 29 5 144 3 hisB Histidine biosynthesis bifunctional protein HisB Baumannia cicadellinicola subsp. Homalodisca coagulata
Q60330 5.04e-09 54 48 1 54 4 MJ0015 Uncharacterized protein MJ0015 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5H0K9 2.23e-08 56 27 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SKN6 2.23e-08 56 27 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3K1 2.23e-08 56 27 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BUF5 4.32e-08 55 26 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0RSL6 5.48e-08 55 28 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain B100)
Q8ABA7 7.84e-08 54 26 2 138 1 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64RE9 1.31e-07 53 25 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain YCH46)
Q5LB00 1.31e-07 53 25 2 143 3 hisB Histidine biosynthesis bifunctional protein HisB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B4STN9 1.6e-07 53 25 6 199 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain R551-3)
P58881 1.7e-07 53 26 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas axonopodis pv. citri (strain 306)
B2FPM1 1.9e-07 53 27 3 144 3 hisB Histidine biosynthesis bifunctional protein HisB Stenotrophomonas maltophilia (strain K279a)
P58882 1.96e-07 53 27 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU42 1.96e-07 53 27 3 139 3 hisB Histidine biosynthesis bifunctional protein HisB Xanthomonas campestris pv. campestris (strain 8004)
B0U3B1 6.06e-06 49 26 3 144 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M12)
Q87C31 6.79e-06 48 26 3 144 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5X9 6.79e-06 48 26 3 144 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain M23)
Q9PBC7 6.98e-06 48 26 3 144 3 hisB Histidine biosynthesis bifunctional protein HisB Xylella fastidiosa (strain 9a5c)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_08925
Feature type CDS
Gene gmhB
Product D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
Location 846 - 1427 (strand: -1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1040
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13242 HAD-hyrolase-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0241 Amino acid transport and metabolism (E) E Histidinol phosphatase/D-glycero-mannoheptose bisphosphatephosphatase, HAD superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03273 D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83] Lipopolysaccharide biosynthesis
Metabolic pathways
Biosynthesis of nucleotide sugars		 ADP-L-glycero-D-manno-heptose biosynthesis

Protein Sequence

MGIPAVFLDRDGTINVDTGYLHEIDDFQFIENAIEAMQAIKQMGYALIIVTNQSGIARGMFTEDQFMHLTEWMDWSLADRGVDLDGIYYCPHHPEGTVEEFRQECNCRKPEPGMLLDAQKFLKIDMSNSYMVGDKLDDMLAGRAAEVGTTVLVRTGKPVTEDAEAAADIVINSIADLPALLKPVQKSAKSPKK

Flanking regions ( +/- flanking 50bp)

CAAATAGGCGATACTAAATACATTATTGATGACGGACTAAGAGTGTAACCATGGGTATCCCCGCAGTATTTCTGGACAGAGACGGCACCATTAACGTAGATACCGGCTATCTCCATGAGATTGATGATTTTCAGTTTATAGAGAACGCGATTGAAGCAATGCAGGCCATCAAGCAGATGGGCTACGCTTTAATCATAGTCACAAATCAGTCGGGTATTGCCCGCGGTATGTTTACCGAAGATCAGTTTATGCATCTGACAGAATGGATGGACTGGTCTCTGGCGGATCGCGGCGTTGACCTGGATGGTATCTATTATTGTCCTCATCATCCCGAAGGTACTGTCGAAGAGTTTCGTCAGGAATGTAACTGCCGTAAACCGGAGCCGGGTATGCTGCTGGATGCACAGAAATTTCTGAAGATCGATATGAGTAACTCTTATATGGTAGGGGATAAGCTCGACGATATGCTGGCCGGACGGGCAGCCGAAGTGGGTACAACCGTATTGGTACGCACCGGTAAACCGGTAACGGAAGACGCCGAAGCGGCGGCAGATATTGTGATTAACAGTATCGCGGATTTACCTGCACTGCTGAAACCCGTACAAAAAAGCGCAAAATCACCTAAAAAGTAACCCGATTGGGTGTTTTATCTGCAAACAGAAAAAAAGTTGAAATAAACACT