Homologs in group_1845

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13415 FBDBKF_13415 100.0 Morganella morganii S1 rplT 50S ribosomal protein L20
NLDBIP_09005 NLDBIP_09005 100.0 Morganella morganii S4 rplT 50S ribosomal protein L20
LHKJJB_05260 LHKJJB_05260 100.0 Morganella morganii S3 rplT 50S ribosomal protein L20
HKOGLL_05655 HKOGLL_05655 100.0 Morganella morganii S5 rplT 50S ribosomal protein L20
F4V73_RS03350 F4V73_RS03350 97.5 Morganella psychrotolerans rplT 50S ribosomal protein L20
PMI_RS05040 PMI_RS05040 95.8 Proteus mirabilis HI4320 rplT 50S ribosomal protein L20

Distribution of the homologs in the orthogroup group_1845

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1845

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JJ20 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z3 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL4 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pestis (strain Pestoides F)
Q1CIG6 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A5 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDW8 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pestis
B2K665 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C731 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG4 6.66e-75 220 96 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4ETK9 2.63e-74 219 95 0 118 3 rplT Large ribosomal subunit protein bL20 Proteus mirabilis (strain HI4320)
P0A480 7.74e-72 212 94 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio mimicus
C3LUW1 7.74e-72 212 94 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio cholerae serotype O1 (strain M66-2)
P0A479 7.74e-72 212 94 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5EZ15 7.74e-72 212 94 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q2NT29 1.02e-71 212 93 0 117 3 rplT Large ribosomal subunit protein bL20 Sodalis glossinidius (strain morsitans)
Q9ALJ1 5.64e-71 210 92 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio metschnikovii
Q15SX6 1.45e-70 209 89 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7MK68 4.16e-70 208 91 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio vulnificus (strain YJ016)
P0A482 4.16e-70 208 91 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio vulnificus (strain CMCP6)
P0A481 4.16e-70 208 91 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N012 4.16e-70 208 91 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio campbellii (strain ATCC BAA-1116)
B7VN20 4.54e-70 208 90 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio atlanticus (strain LGP32)
B1KG58 1.4e-69 207 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CMF1 1.4e-69 207 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q6LQ71 1.85e-69 206 90 0 117 3 rplT Large ribosomal subunit protein bL20 Photobacterium profundum (strain SS9)
Q5QYN7 2.87e-69 206 90 0 117 3 rplT Large ribosomal subunit protein bL20 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8FV59 4.25e-69 206 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella sediminis (strain HAW-EB3)
Q84BL4 4.3e-69 205 90 0 117 3 rplT Large ribosomal subunit protein bL20 Vibrio anguillarum
A1S6G7 7.52e-69 205 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H4U3 1.33e-68 204 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TT23 1.33e-68 204 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella halifaxensis (strain HAW-EB4)
A4SMA7 1.44e-68 204 88 0 117 3 rplT Large ribosomal subunit protein bL20 Aeromonas salmonicida (strain A449)
A0KKP6 1.44e-68 204 88 0 117 3 rplT Large ribosomal subunit protein bL20 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1RJI6 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella sp. (strain W3-18-1)
Q0HV48 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella sp. (strain MR-7)
Q0HIT6 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella sp. (strain MR-4)
A0KWV7 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella sp. (strain ANA-3)
A4Y703 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EER6 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12NI4 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9L2Q6 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella baltica (strain OS195)
A6WNG9 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella baltica (strain OS185)
A3D4I5 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EES9 3.35e-68 203 88 0 117 3 rplT Large ribosomal subunit protein bL20 Shewanella baltica (strain OS223)
B5FDV4 3.62e-68 203 89 0 117 3 rplT Large ribosomal subunit protein bL20 Aliivibrio fischeri (strain MJ11)
Q5E5I3 3.62e-68 203 89 0 117 3 rplT Large ribosomal subunit protein bL20 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q082E4 3.99e-68 203 87 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella frigidimarina (strain NCIMB 400)
A3QEJ7 4.91e-68 203 88 0 118 3 rplT Large ribosomal subunit protein bL20 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3IL78 5.13e-68 203 86 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudoalteromonas translucida (strain TAC 125)
C4LFH0 9.29e-68 202 87 0 118 3 rplT Large ribosomal subunit protein bL20 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q321K7 4.49e-67 200 96 0 106 3 rplT Large ribosomal subunit protein bL20 Shigella boydii serotype 4 (strain Sb227)
A1SWU2 2.47e-65 196 86 0 118 3 rplT Large ribosomal subunit protein bL20 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9I0A2 1.09e-64 194 86 0 118 1 rplT Large ribosomal subunit protein bL20 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN8 1.09e-64 194 86 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V309 1.09e-64 194 86 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas aeruginosa (strain LESB58)
A6V488 1.09e-64 194 86 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas aeruginosa (strain PA7)
Q3Z264 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Shigella sonnei (strain Ss046)
B2U394 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7L6 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7L7 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella typhi
B4TUF3 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella schwarzengrund (strain CVM19633)
B5BA39 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella paratyphi A (strain AKU_12601)
C0Q644 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella paratyphi C (strain RKS4594)
A9N240 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH91 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N1 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella newport (strain SL254)
B4TGH4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella heidelberg (strain SL476)
B5RAX0 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW5 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella enteritidis PT4 (strain P125109)
B5FJA5 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella dublin (strain CT_02021853)
Q57PV0 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella choleraesuis (strain SC-B67)
B5F7F9 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella agona (strain SL483)
A6TAI4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQC9 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Klebsiella pneumoniae (strain 342)
B7LQ74 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB79 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain UTI89 / UPEC)
B1LE15 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain SMS-3-5 / SECEC)
B6IBD4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain SE11)
B7N553 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7L3 6.87e-64 192 95 0 118 1 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain K12)
B1IPL2 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7L4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB3 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABQ0 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O1:K1 / APEC
A8A0Q9 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O9:H4 (strain HS)
B1XG23 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain K12 / DH10B)
C4ZYH8 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O8 (strain IAI1)
B7MVJ4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O81 (strain ED1a)
B7NT61 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ04 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7L5 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O157:H7
B7L6I9 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli (strain 55989 / EAEC)
B7MAS6 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US99 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMI4 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AHA8 6.87e-64 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4XTS4 7.1e-64 192 86 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas mendocina (strain ymp)
C5B849 1.3e-63 192 95 0 118 3 rplT Large ribosomal subunit protein bL20 Edwardsiella ictaluri (strain 93-146)
Q83RG1 1.71e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Shigella flexneri
Q0T4S6 1.71e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Shigella flexneri serotype 5b (strain 8401)
Q32FI3 1.71e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Shigella dysenteriae serotype 1 (strain Sd197)
A4W9M6 1.8e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Enterobacter sp. (strain 638)
Q4ZUG4 1.82e-63 191 85 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas syringae pv. syringae (strain B728a)
P0A160 1.82e-63 191 85 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas syringae pv. syringae
P0A159 1.82e-63 191 85 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEX9 1.82e-63 191 85 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas fluorescens (strain Pf0-1)
Q48JS0 1.82e-63 191 85 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C1DF45 2.43e-63 191 84 0 118 3 rplT Large ribosomal subunit protein bL20 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B6EN31 2.45e-63 191 92 0 106 3 rplT Large ribosomal subunit protein bL20 Aliivibrio salmonicida (strain LFI1238)
C6DFY9 2.99e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H1 2.99e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MFC0 3.26e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MNZ1 3.26e-63 191 94 0 118 3 rplT Large ribosomal subunit protein bL20 Cronobacter sakazakii (strain ATCC BAA-894)
Q9X6E8 3.48e-63 191 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q4KEW1 3.48e-63 191 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1J6U7 5.06e-63 190 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas putida (strain W619)
Q88K24 5.06e-63 190 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR5 5.06e-63 190 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas putida (strain GB-1)
A5W5D8 5.06e-63 190 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IC12 5.06e-63 190 84 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas entomophila (strain L48)
Q7N3P9 5.71e-63 190 95 0 118 3 rplT Large ribosomal subunit protein bL20 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9CN41 1.1e-62 189 94 0 117 3 rplT Large ribosomal subunit protein bL20 Pasteurella multocida (strain Pm70)
A5WHW6 1.36e-62 189 83 0 118 3 rplT Large ribosomal subunit protein bL20 Psychrobacter sp. (strain PRwf-1)
Q8RPZ9 1.77e-62 189 83 0 118 3 rplT Large ribosomal subunit protein bL20 Azotobacter vinelandii
B2VEL7 1.79e-62 189 94 0 118 3 rplT Large ribosomal subunit protein bL20 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JMK7 1.83e-62 189 94 0 118 3 rplT Large ribosomal subunit protein bL20 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C3JZN4 2.01e-62 189 83 0 118 3 rplT Large ribosomal subunit protein bL20 Pseudomonas fluorescens (strain SBW25)
B0V5Q9 2.51e-62 188 82 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain AYE)
A3M2A4 2.51e-62 188 82 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HTH6 2.51e-62 188 82 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain ACICU)
B7I694 2.51e-62 188 82 0 118 1 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain AB0057)
B7GZZ9 2.51e-62 188 82 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain AB307-0294)
Q6F868 2.51e-62 188 82 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0UU75 2.96e-62 188 94 0 117 3 rplT Large ribosomal subunit protein bL20 Histophilus somni (strain 2336)
Q0I3J1 2.96e-62 188 94 0 117 3 rplT Large ribosomal subunit protein bL20 Histophilus somni (strain 129Pt)
A4VM19 3.23e-62 188 83 0 118 3 rplT Large ribosomal subunit protein bL20 Stutzerimonas stutzeri (strain A1501)
A8GDQ8 4.11e-62 188 95 0 118 3 rplT Large ribosomal subunit protein bL20 Serratia proteamaculans (strain 568)
B0VV91 7.76e-62 187 81 0 118 3 rplT Large ribosomal subunit protein bL20 Acinetobacter baumannii (strain SDF)
Q1QWK4 8.77e-62 187 82 0 116 3 rplT Large ribosomal subunit protein bL20 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VNG1 8.85e-62 187 82 0 118 3 rplT Large ribosomal subunit protein bL20 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q65TP7 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44358 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEZ1 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Haemophilus influenzae (strain PittGG)
A5UC92 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Haemophilus influenzae (strain PittEE)
Q4QKK6 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Haemophilus influenzae (strain 86-028NP)
B0BSM8 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MYU7 1.07e-61 187 94 0 117 3 rplT Large ribosomal subunit protein bL20 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VPA9 2.35e-61 186 93 0 117 3 rplT Large ribosomal subunit protein bL20 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKS2 2.93e-61 186 94 0 117 3 rplT Large ribosomal subunit protein bL20 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q31F17 3.03e-61 186 77 0 118 3 rplT Large ribosomal subunit protein bL20 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B4RSL5 3.13e-61 186 92 0 118 3 rplT Large ribosomal subunit protein bL20 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B3H067 4.07e-61 185 93 0 117 3 rplT Large ribosomal subunit protein bL20 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q7NYC3 4.34e-61 185 78 0 118 3 rplT Large ribosomal subunit protein bL20 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6VYH8 5.24e-61 185 82 0 118 3 rplT Large ribosomal subunit protein bL20 Marinomonas sp. (strain MWYL1)
Q60AZ1 7.14e-61 184 84 0 115 3 rplT Large ribosomal subunit protein bL20 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1Q8C6 1.34e-60 184 80 0 118 3 rplT Large ribosomal subunit protein bL20 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQ64 1.34e-60 184 80 0 118 3 rplT Large ribosomal subunit protein bL20 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1LT07 2.45e-60 183 76 0 118 3 rplT Large ribosomal subunit protein bL20 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2SDJ5 2.57e-60 183 79 0 118 3 rplT Large ribosomal subunit protein bL20 Hahella chejuensis (strain KCTC 2396)
Q480B2 3.3e-60 183 91 0 118 3 rplT Large ribosomal subunit protein bL20 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B8F7W4 1.09e-59 182 91 0 117 3 rplT Large ribosomal subunit protein bL20 Glaesserella parasuis serovar 5 (strain SH0165)
A1U2C0 3.42e-59 181 79 0 117 3 rplT Large ribosomal subunit protein bL20 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1K4E4 1.79e-58 179 75 0 118 3 rplT Large ribosomal subunit protein bL20 Azoarcus sp. (strain BH72)
Q83C13 3.27e-58 178 78 0 117 3 rplT Large ribosomal subunit protein bL20 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8K2 3.27e-58 178 78 0 117 3 rplT Large ribosomal subunit protein bL20 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGB8 3.27e-58 178 78 0 117 3 rplT Large ribosomal subunit protein bL20 Coxiella burnetii (strain Dugway 5J108-111)
B6IZF9 3.27e-58 178 78 0 117 3 rplT Large ribosomal subunit protein bL20 Coxiella burnetii (strain CbuG_Q212)
B6J7X8 3.27e-58 178 78 0 117 3 rplT Large ribosomal subunit protein bL20 Coxiella burnetii (strain CbuK_Q154)
Q5P7X8 3.65e-58 178 75 0 118 3 rplT Large ribosomal subunit protein bL20 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0AAL8 6.45e-58 177 74 0 118 3 rplT Large ribosomal subunit protein bL20 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q89AV8 4.22e-57 176 70 0 118 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1GZS0 1.15e-56 174 74 0 118 3 rplT Large ribosomal subunit protein bL20 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5WT85 1.45e-56 174 83 0 106 3 rplT Large ribosomal subunit protein bL20 Legionella pneumophila (strain Lens)
Q5ZS07 1.45e-56 174 83 0 106 3 rplT Large ribosomal subunit protein bL20 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAL2 1.45e-56 174 83 0 106 3 rplT Large ribosomal subunit protein bL20 Legionella pneumophila (strain Corby)
Q5X1H6 1.45e-56 174 83 0 106 3 rplT Large ribosomal subunit protein bL20 Legionella pneumophila (strain Paris)
Q2YBS3 5.85e-56 172 73 0 118 3 rplT Large ribosomal subunit protein bL20 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A5EVM2 1.6e-55 171 72 0 118 3 rplT Large ribosomal subunit protein bL20 Dichelobacter nodosus (strain VCS1703A)
Q21KD7 2.54e-55 171 74 0 118 3 rplT Large ribosomal subunit protein bL20 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q492V2 6.17e-55 170 69 0 114 3 rplT Large ribosomal subunit protein bL20 Blochmanniella pennsylvanica (strain BPEN)
C5BSQ5 7.61e-55 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q13WG0 9.47e-55 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Paraburkholderia xenovorans (strain LB400)
B2SZF9 9.47e-55 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0BG03 9.47e-55 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YP16 9.47e-55 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia ambifaria (strain MC40-6)
A4G616 1.02e-54 169 69 0 118 3 rplT Large ribosomal subunit protein bL20 Herminiimonas arsenicoxydans
Q3JBZ9 1.07e-54 169 72 0 118 3 rplT Large ribosomal subunit protein bL20 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6SY33 1.81e-54 169 69 0 118 3 rplT Large ribosomal subunit protein bL20 Janthinobacterium sp. (strain Marseille)
B2SUM0 3.53e-54 168 76 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q82VV4 4.03e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1W8I3 4.4e-54 167 72 0 118 3 rplT Large ribosomal subunit protein bL20 Acidovorax sp. (strain JS42)
B4SQH1 5.01e-54 167 76 0 118 3 rplT Large ribosomal subunit protein bL20 Stenotrophomonas maltophilia (strain R551-3)
B2JJJ4 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JDU7 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SVE1 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63TM5 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia pseudomallei (strain K96243)
A3N8T4 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia pseudomallei (strain 668)
Q3JT10 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia pseudomallei (strain 1710b)
A3NUI7 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia pseudomallei (strain 1106a)
Q1BWV0 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia orbicola (strain AU 1054)
B1K094 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia orbicola (strain MC0-3)
A1V3R0 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia mallei (strain SAVP1)
Q62KI5 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia mallei (strain ATCC 23344)
A2S2N4 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia mallei (strain NCTC 10229)
A3MJU1 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia mallei (strain NCTC 10247)
A9ABF6 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39H52 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E7I8 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K6V3 5.6e-54 167 71 0 118 3 rplT Large ribosomal subunit protein bL20 Burkholderia cenocepacia (strain HI2424)
B9MHY1 5.72e-54 167 72 0 118 3 rplT Large ribosomal subunit protein bL20 Acidovorax ebreus (strain TPSY)
Q057Z1 7.77e-54 167 70 0 118 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q21YT0 2.13e-53 166 71 0 118 3 rplT Large ribosomal subunit protein bL20 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1WMG8 2.68e-53 166 72 0 118 3 rplT Large ribosomal subunit protein bL20 Verminephrobacter eiseniae (strain EF01-2)
B8GRI3 2.8e-53 166 78 0 106 3 rplT Large ribosomal subunit protein bL20 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1TR36 2.86e-53 166 70 0 118 3 rplT Large ribosomal subunit protein bL20 Paracidovorax citrulli (strain AAC00-1)
Q5GXY3 3.27e-53 165 75 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P0Z8 3.27e-53 165 75 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU0 3.27e-53 165 75 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PJE3 3.27e-53 165 75 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas axonopodis pv. citri (strain 306)
Q0ADN7 3.41e-53 165 69 0 118 3 rplT Large ribosomal subunit protein bL20 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B2FN76 4.59e-53 165 75 0 118 3 rplT Large ribosomal subunit protein bL20 Stenotrophomonas maltophilia (strain K279a)
Q8P7Z4 6.31e-53 165 74 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH2 6.31e-53 165 74 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas campestris pv. campestris (strain B100)
Q4UW54 6.31e-53 165 74 0 118 3 rplT Large ribosomal subunit protein bL20 Xanthomonas campestris pv. campestris (strain 8004)
Q8XZ26 7.95e-53 164 67 0 118 3 rplT Large ribosomal subunit protein bL20 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A9C3D1 1.95e-52 163 70 0 118 3 rplT Large ribosomal subunit protein bL20 Delftia acidovorans (strain DSM 14801 / SPH-1)
C5CUU5 2.46e-52 163 70 0 118 3 rplT Large ribosomal subunit protein bL20 Variovorax paradoxus (strain S110)
B0TY86 2.49e-52 163 76 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q9PFD8 3.09e-52 163 73 0 118 3 rplT Large ribosomal subunit protein bL20 Xylella fastidiosa (strain 9a5c)
Q87AB4 3.13e-52 163 72 0 118 3 rplT Large ribosomal subunit protein bL20 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9P5 3.13e-52 163 72 0 118 3 rplT Large ribosomal subunit protein bL20 Xylella fastidiosa (strain M23)
B3R4J4 3.61e-52 163 66 0 118 3 rplT Large ribosomal subunit protein bL20 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q472N5 3.61e-52 163 66 0 118 3 rplT Large ribosomal subunit protein bL20 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KBZ0 3.61e-52 163 66 0 118 3 rplT Large ribosomal subunit protein bL20 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LP77 3.61e-52 163 66 0 118 3 rplT Large ribosomal subunit protein bL20 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3SK31 4.44e-52 162 69 0 118 3 rplT Large ribosomal subunit protein bL20 Thiobacillus denitrificans (strain ATCC 25259)
B8D733 4.59e-52 162 82 0 117 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57228 4.59e-52 162 82 0 117 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B2UGJ5 4.7e-52 162 66 0 118 3 rplT Large ribosomal subunit protein bL20 Ralstonia pickettii (strain 12J)
B0U5E0 6.81e-52 162 72 0 118 3 rplT Large ribosomal subunit protein bL20 Xylella fastidiosa (strain M12)
B8D8S9 7.44e-52 162 82 0 117 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A0Q759 7.95e-52 162 76 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. novicida (strain U112)
Q0BL44 9.37e-52 162 75 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2J3 9.37e-52 162 75 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. holarctica (strain LVS)
A7NDB3 9.37e-52 162 75 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IX71 1.1e-51 161 75 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. tularensis (strain WY96-3418)
B2SGS0 1.69e-51 161 75 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. mediasiatica (strain FSC147)
A7HPK9 2.28e-51 160 67 0 117 3 rplT Large ribosomal subunit protein bL20 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2KZL8 2.32e-51 160 69 0 118 3 rplT Large ribosomal subunit protein bL20 Bordetella avium (strain 197N)
Q12BR0 3.41e-51 160 67 0 118 3 rplT Large ribosomal subunit protein bL20 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q47CM7 3.93e-51 160 75 0 104 3 rplT Large ribosomal subunit protein bL20 Dechloromonas aromatica (strain RCB)
Q5NGL5 4.21e-51 160 74 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I17 4.21e-51 160 74 0 106 3 rplT Large ribosomal subunit protein bL20 Francisella tularensis subsp. tularensis (strain FSC 198)
Q7VVR3 4.44e-51 160 68 0 118 3 rplT Large ribosomal subunit protein bL20 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7C8 4.44e-51 160 68 0 118 3 rplT Large ribosomal subunit protein bL20 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR6 4.44e-51 160 68 0 118 3 rplT Large ribosomal subunit protein bL20 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9IPU1 8.75e-51 159 67 0 118 3 rplT Large ribosomal subunit protein bL20 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WU56 9.04e-51 159 66 0 118 3 rplT Large ribosomal subunit protein bL20 Halorhodospira halophila (strain DSM 244 / SL1)
A1VR74 9.87e-51 159 68 0 117 3 rplT Large ribosomal subunit protein bL20 Polaromonas naphthalenivorans (strain CJ2)
Q8D3B7 2.23e-50 158 65 0 115 3 rplT Large ribosomal subunit protein bL20 Wigglesworthia glossinidia brevipalpis
B1XYZ6 4.2e-50 157 67 0 118 3 rplT Large ribosomal subunit protein bL20 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
C1DDA3 5.11e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Laribacter hongkongensis (strain HLHK9)
A4J4Z0 5.12e-50 157 67 0 118 3 rplT Large ribosomal subunit protein bL20 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A1KSY5 6.43e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JVA1 7.83e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M378 7.83e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria meningitidis serogroup C (strain 053442)
B4RJY6 7.83e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria gonorrhoeae (strain NCCP11945)
Q5F9U1 7.83e-50 157 80 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C4K779 9.25e-50 157 87 0 106 3 rplT Large ribosomal subunit protein bL20 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P46246 1.08e-49 156 79 0 117 3 rplT Large ribosomal subunit protein bL20 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9K093 1.97e-49 156 79 0 118 3 rplT Large ribosomal subunit protein bL20 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q3ABS9 3.3e-49 155 65 0 117 3 rplT Large ribosomal subunit protein bL20 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7VR68 4.06e-49 155 66 0 114 3 rplT Large ribosomal subunit protein bL20 Blochmanniella floridana
Q11KK1 1.66e-48 154 65 0 117 3 rplT Large ribosomal subunit protein bL20 Chelativorans sp. (strain BNC1)
B8I169 1.71e-48 153 67 0 116 3 rplT Large ribosomal subunit protein bL20 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B1HWC8 1.96e-48 153 67 0 109 3 rplT Large ribosomal subunit protein bL20 Lysinibacillus sphaericus (strain C3-41)
B5EN54 2.22e-48 153 66 0 118 3 rplT Large ribosomal subunit protein bL20 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7S7 2.22e-48 153 66 0 118 3 rplT Large ribosomal subunit protein bL20 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B9DNC4 3.55e-48 152 62 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus carnosus (strain TM300)
Q4L719 3.63e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus haemolyticus (strain JCSC1435)
A3DES6 4.2e-48 152 65 0 117 3 rplT Large ribosomal subunit protein bL20 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
P66109 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain MW2)
Q6G8P7 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain MSSA476)
Q6GG27 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain MRSA252)
P66108 5.39e-48 152 63 0 117 1 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain N315)
P66107 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHL2 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain Newman)
Q5HF94 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain COL)
Q2YTB1 5.39e-48 152 63 0 117 1 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ITK3 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain JH9)
Q2FXQ1 5.39e-48 152 63 0 117 1 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FG58 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain USA300)
A6U2E6 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain JH1)
A7X3A1 5.39e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CS77 6.94e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNM5 6.94e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49YB0 8.63e-48 152 63 0 117 3 rplT Large ribosomal subunit protein bL20 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B8IP77 1.47e-47 151 63 0 118 3 rplT Large ribosomal subunit protein bL20 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B1ZGB4 1.48e-47 151 62 0 118 3 rplT Large ribosomal subunit protein bL20 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B3PL13 1.49e-47 151 75 0 102 3 rplT Large ribosomal subunit protein bL20 Cellvibrio japonicus (strain Ueda107)
B9E782 3.75e-47 150 61 0 117 3 rplT Large ribosomal subunit protein bL20 Macrococcus caseolyticus (strain JCSC5402)
A9W371 4.95e-47 150 61 0 118 3 rplT Large ribosomal subunit protein bL20 Methylorubrum extorquens (strain PA1)
B4R9C5 5.09e-47 150 66 0 118 3 rplT Large ribosomal subunit protein bL20 Phenylobacterium zucineum (strain HLK1)
A4IRN1 6.4e-47 149 64 0 117 3 rplT Large ribosomal subunit protein bL20 Geobacillus thermodenitrificans (strain NG80-2)
B1I4I8 8.04e-47 149 63 0 117 3 rplT Large ribosomal subunit protein bL20 Desulforudis audaxviator (strain MP104C)
B7GGV3 8.51e-47 149 64 0 117 3 rplT Large ribosomal subunit protein bL20 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q6G5E4 9.14e-47 149 64 0 117 3 rplT Large ribosomal subunit protein bL20 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B2A5N9 1.12e-46 149 61 0 117 3 rplT Large ribosomal subunit protein bL20 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q6G1G7 1.13e-46 149 65 0 117 3 rplT Large ribosomal subunit protein bL20 Bartonella quintana (strain Toulouse)
Q28V94 1.23e-46 149 63 1 119 3 rplT Large ribosomal subunit protein bL20 Jannaschia sp. (strain CCS1)
A5E8L8 1.25e-46 149 62 0 118 3 rplT Large ribosomal subunit protein bL20 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B6IPJ8 1.52e-46 149 63 0 118 3 rplT Large ribosomal subunit protein bL20 Rhodospirillum centenum (strain ATCC 51521 / SW)
A8FG25 1.64e-46 148 60 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus pumilus (strain SAFR-032)
Q2RHN2 2.2e-46 148 64 0 118 3 rplT Large ribosomal subunit protein bL20 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A7Z7H3 2.21e-46 148 60 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5KWD5 2.6e-46 148 64 0 117 3 rplT Large ribosomal subunit protein bL20 Geobacillus kaustophilus (strain HTA426)
C5D636 2.97e-46 148 64 0 117 3 rplT Large ribosomal subunit protein bL20 Geobacillus sp. (strain WCH70)
A1UUA9 3.36e-46 148 64 0 117 3 rplT Large ribosomal subunit protein bL20 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0UPJ6 3.45e-46 148 61 0 118 3 rplT Large ribosomal subunit protein bL20 Methylobacterium sp. (strain 4-46)
A9ILQ7 3.75e-46 148 63 0 117 3 rplT Large ribosomal subunit protein bL20 Bartonella tribocorum (strain CIP 105476 / IBS 506)
P13070 4.12e-46 147 64 0 117 3 rplT Large ribosomal subunit protein bL20 Geobacillus stearothermophilus
Q0ATG2 4.76e-46 147 62 0 117 3 rplT Large ribosomal subunit protein bL20 Maricaulis maris (strain MCS10)
Q837C7 6.82e-46 147 61 0 118 1 rplT Large ribosomal subunit protein bL20 Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FUA0 8.41e-46 147 65 0 118 3 rplT Large ribosomal subunit protein bL20 Gluconobacter oxydans (strain 621H)
P55873 1.47e-45 146 59 0 117 1 rplT Large ribosomal subunit protein bL20 Bacillus subtilis (strain 168)
A2SH04 1.49e-45 146 69 0 118 3 rplT Large ribosomal subunit protein bL20 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3A4P0 2.16e-45 145 64 0 117 3 rplT Large ribosomal subunit protein bL20 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q1GNX8 2.58e-45 145 60 0 118 3 rplT Large ribosomal subunit protein bL20 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q65GB5 2.71e-45 145 59 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5D0U4 3.1e-45 145 63 0 117 3 rplT Large ribosomal subunit protein bL20 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B9DU42 4.59e-45 145 62 0 118 3 rplT Large ribosomal subunit protein bL20 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A0L4J9 5.03e-45 145 58 0 117 3 rplT Large ribosomal subunit protein bL20 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C0Z9B6 5.35e-45 145 61 0 117 3 rplT Large ribosomal subunit protein bL20 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2VYY8 5.36e-45 144 64 0 117 3 rplT Large ribosomal subunit protein bL20 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8UIN7 6.17e-45 145 62 0 117 3 rplT Large ribosomal subunit protein bL20 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8R9C4 6.95e-45 144 64 0 117 3 rplT Large ribosomal subunit protein bL20 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9VJN6 1.17e-44 144 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus mycoides (strain KBAB4)
A7GVX8 1.33e-44 144 62 0 117 3 rplT Large ribosomal subunit protein bL20 Campylobacter curvus (strain 525.92)
B8H308 1.53e-44 143 63 0 118 3 rplT Large ribosomal subunit protein bL20 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9E3 1.53e-44 143 63 0 118 3 rplT Large ribosomal subunit protein bL20 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C3MCP9 1.55e-44 144 62 0 118 3 rplT Large ribosomal subunit protein bL20 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P66103 1.62e-44 143 61 0 118 1 rplT Large ribosomal subunit protein bL20 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71YN5 1.62e-44 143 61 0 118 3 rplT Large ribosomal subunit protein bL20 Listeria monocytogenes serotype 4b (strain F2365)
P66104 1.62e-44 143 61 0 118 3 rplT Large ribosomal subunit protein bL20 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9JYM9 2.4e-44 144 60 0 118 3 rplT Large ribosomal subunit protein bL20 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1J0V8 2.45e-44 143 58 0 116 3 rplT Large ribosomal subunit protein bL20 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8DV20 2.48e-44 143 61 0 118 3 rplT Large ribosomal subunit protein bL20 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8EPF7 2.74e-44 143 58 0 117 3 rplT Large ribosomal subunit protein bL20 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6HCV7 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633M3 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain ZK / E33L)
Q817H7 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9J073 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain Q1)
B7HRL2 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain AH187)
B7HF86 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain B4264)
C1EUR7 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain 03BB102)
B7IJX1 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain G9842)
Q72ZG4 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JR80 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cereus (strain AH820)
Q81L17 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus anthracis
A0RJH2 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus thuringiensis (strain Al Hakam)
C3L8V1 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAG2 4.11e-44 142 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus anthracis (strain A0248)
A8LLH0 4.76e-44 142 60 1 120 3 rplT Large ribosomal subunit protein bL20 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
C4ZBG1 6.51e-44 142 62 0 118 3 rplT Large ribosomal subunit protein bL20 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A4XKC1 6.65e-44 142 65 0 112 3 rplT Large ribosomal subunit protein bL20 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9J7G2 8.26e-44 142 59 0 117 3 rplT Large ribosomal subunit protein bL20 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A7ZAY0 8.56e-44 142 61 0 117 3 rplT Large ribosomal subunit protein bL20 Campylobacter concisus (strain 13826)
Q1WUM9 8.9e-44 142 61 0 118 3 rplT Large ribosomal subunit protein bL20 Ligilactobacillus salivarius (strain UCC118)
Q0AY02 9.14e-44 141 60 0 114 3 rplT Large ribosomal subunit protein bL20 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9RSW7 1.03e-43 141 56 0 116 1 rplT Large ribosomal subunit protein bL20 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q92ST1 1.07e-43 142 61 0 118 3 rplT Large ribosomal subunit protein bL20 Rhizobium meliloti (strain 1021)
P66102 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella suis biovar 1 (strain 1330)
B0CJL8 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT72 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66101 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG04 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9V2 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AE2 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella abortus biovar 1 (strain 9-941)
Q2YQV7 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella abortus (strain 2308)
B2S9B6 1.1e-43 142 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella abortus (strain S19)
Q2N635 1.12e-43 141 57 0 118 3 rplT Large ribosomal subunit protein bL20 Erythrobacter litoralis (strain HTCC2594)
A6UF73 1.13e-43 142 61 0 118 3 rplT Large ribosomal subunit protein bL20 Sinorhizobium medicae (strain WSM419)
A6Q169 1.19e-43 141 61 0 115 3 rplT Large ribosomal subunit protein bL20 Nitratiruptor sp. (strain SB155-2)
Q73GR7 1.33e-43 141 63 0 118 3 rplT Large ribosomal subunit protein bL20 Wolbachia pipientis wMel
Q1GDM1 1.33e-43 141 60 1 120 3 rplT Large ribosomal subunit protein bL20 Ruegeria sp. (strain TM1040)
B0K3L3 1.49e-43 141 63 0 117 3 rplT Large ribosomal subunit protein bL20 Thermoanaerobacter sp. (strain X514)
C0R3S6 1.52e-43 141 63 0 118 3 rplT Large ribosomal subunit protein bL20 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B0K8B5 1.63e-43 141 63 0 117 3 rplT Large ribosomal subunit protein bL20 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A9H170 1.65e-43 141 61 0 118 3 rplT Large ribosomal subunit protein bL20 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B5ZXR9 1.76e-43 141 61 0 117 3 rplT Large ribosomal subunit protein bL20 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A7GTM0 1.8e-43 140 58 0 117 3 rplT Large ribosomal subunit protein bL20 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A6WX18 1.94e-43 141 62 0 117 3 rplT Large ribosomal subunit protein bL20 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B0SXZ8 2.01e-43 140 62 0 118 3 rplT Large ribosomal subunit protein bL20 Caulobacter sp. (strain K31)
A5V924 2.18e-43 140 60 0 118 3 rplT Large ribosomal subunit protein bL20 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2LR24 2.19e-43 140 60 0 115 3 rplT Large ribosomal subunit protein bL20 Syntrophus aciditrophicus (strain SB)
A6TNP4 2.19e-43 140 60 0 117 3 rplT Large ribosomal subunit protein bL20 Alkaliphilus metalliredigens (strain QYMF)
Q5WEI8 2.61e-43 140 60 0 117 3 rplT Large ribosomal subunit protein bL20 Shouchella clausii (strain KSM-K16)
Q16BG8 2.65e-43 140 60 1 120 3 rplT Large ribosomal subunit protein bL20 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B3PYE1 2.91e-43 140 61 0 117 3 rplT Large ribosomal subunit protein bL20 Rhizobium etli (strain CIAT 652)
Q1MMP4 3.5e-43 140 60 0 117 3 rplT Large ribosomal subunit protein bL20 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q98CP8 3.59e-43 140 64 0 106 3 rplT Large ribosomal subunit protein bL20 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9K869 3.66e-43 140 59 0 117 3 rplT Large ribosomal subunit protein bL20 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9MRK2 4.46e-43 140 63 0 112 3 rplT Large ribosomal subunit protein bL20 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A5G2N1 4.62e-43 140 61 0 114 3 rplT Large ribosomal subunit protein bL20 Acidiphilium cryptum (strain JF-5)
B1VH40 5.82e-43 140 59 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q251I4 8.68e-43 139 62 0 114 3 rplT Large ribosomal subunit protein bL20 Desulfitobacterium hafniense (strain Y51)
B8FZK2 8.68e-43 139 62 0 114 3 rplT Large ribosomal subunit protein bL20 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A9KHG9 1.01e-42 139 61 0 118 3 rplT Large ribosomal subunit protein bL20 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q3YSX0 1.08e-42 139 61 0 118 3 rplT Large ribosomal subunit protein bL20 Ehrlichia canis (strain Jake)
A1ARE2 1.1e-42 139 61 0 117 3 rplT Large ribosomal subunit protein bL20 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5NMC1 1.29e-42 139 59 0 118 3 rplT Large ribosomal subunit protein bL20 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A8MI82 1.54e-42 138 58 0 117 3 rplT Large ribosomal subunit protein bL20 Alkaliphilus oremlandii (strain OhILAs)
A8HWM3 1.96e-42 138 58 0 118 3 rplT Large ribosomal subunit protein bL20 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q0RFA0 2.1e-42 138 62 0 111 3 rplT Large ribosomal subunit protein bL20 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q4FNH6 2.12e-42 138 58 0 117 3 rplT Large ribosomal subunit protein bL20 Pelagibacter ubique (strain HTCC1062)
Q891T2 2.13e-42 138 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium tetani (strain Massachusetts / E88)
A4SX36 2.67e-42 138 64 0 117 3 rplT Large ribosomal subunit protein bL20 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B9L884 2.74e-42 137 60 0 115 3 rplT Large ribosomal subunit protein bL20 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q5HC39 3.42e-42 137 63 0 118 3 rplT Large ribosomal subunit protein bL20 Ehrlichia ruminantium (strain Welgevonden)
Q5FH69 3.42e-42 137 63 0 118 3 rplT Large ribosomal subunit protein bL20 Ehrlichia ruminantium (strain Gardel)
Q67QG5 3.55e-42 137 70 0 117 3 rplT Large ribosomal subunit protein bL20 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q97GK7 3.61e-42 137 60 0 114 3 rplT Large ribosomal subunit protein bL20 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q04ZH1 4.09e-42 137 60 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U54 4.09e-42 137 60 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0SRT7 4.16e-42 137 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium perfringens (strain SM101 / Type A)
Q8XJ69 4.16e-42 137 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium perfringens (strain 13 / Type A)
Q0TP68 4.16e-42 137 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A0PZN4 4.21e-42 137 59 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium novyi (strain NT)
Q8FTQ0 4.21e-42 137 61 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C5BW32 4.32e-42 137 60 0 118 3 rplT Large ribosomal subunit protein bL20 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A7I0P1 4.42e-42 137 58 0 117 3 rplT Large ribosomal subunit protein bL20 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q8F6Q7 4.57e-42 137 60 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PL0 4.57e-42 137 60 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q39VS6 5.56e-42 137 61 0 114 3 rplT Large ribosomal subunit protein bL20 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C1D0Q8 5.62e-42 137 56 0 116 3 rplT Large ribosomal subunit protein bL20 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q5GRX9 7.73e-42 137 61 0 118 3 rplT Large ribosomal subunit protein bL20 Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q8NQP6 7.79e-42 137 59 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QDY3 7.79e-42 137 59 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium glutamicum (strain R)
Q2GHR2 8.66e-42 137 61 0 117 3 rplT Large ribosomal subunit protein bL20 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q2J855 8.71e-42 137 61 0 111 3 rplT Large ribosomal subunit protein bL20 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A7IGN4 9.13e-42 136 60 1 120 3 rplT Large ribosomal subunit protein bL20 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
C1CRT9 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CK42 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain P1031)
C1CDV6 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain JJA)
P66113 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IPB5 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain CGSP14)
P66112 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZP58 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IBC1 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain Hungary19A-6)
C1C6T8 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae (strain 70585)
B5E480 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae serotype 19F (strain G54)
Q04KW7 1.15e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1L0T4 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain Loch Maree / Type A3)
A7GI02 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IMV0 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain Okra / Type B1)
C1FKM7 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain Kyoto / Type A2)
A5I6L5 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KTJ7 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain 657 / Type Ba4)
A7FY84 1.4e-41 136 57 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium botulinum (strain ATCC 19397 / Type A)
A5N256 1.47e-41 136 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E5V8 1.47e-41 136 58 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium kluyveri (strain NBRC 12016)
A8AX13 1.62e-41 136 63 0 107 3 rplT Large ribosomal subunit protein bL20 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q5LMG5 1.65e-41 136 62 1 112 3 rplT Large ribosomal subunit protein bL20 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3CRZ0 1.72e-41 136 57 0 118 3 rplT Large ribosomal subunit protein bL20 Orientia tsutsugamushi (strain Ikeda)
B8EM00 1.82e-41 135 57 0 118 3 rplT Large ribosomal subunit protein bL20 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1XV11 1.9e-41 135 64 0 117 3 rplT Large ribosomal subunit protein bL20 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A9NGH5 2.41e-41 135 55 0 118 3 rplT Large ribosomal subunit protein bL20 Acholeplasma laidlawii (strain PG-8A)
B2IBH9 2.44e-41 135 58 0 118 3 rplT Large ribosomal subunit protein bL20 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q38VT4 2.62e-41 135 58 0 117 3 rplT Large ribosomal subunit protein bL20 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6NHH5 2.74e-41 135 58 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B3CLK2 2.78e-41 135 58 0 118 3 rplT Large ribosomal subunit protein bL20 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q2RNH9 4.18e-41 135 58 0 117 3 rplT Large ribosomal subunit protein bL20 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6ANC0 4.2e-41 135 60 0 118 3 rplT Large ribosomal subunit protein bL20 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C4XL14 5.19e-41 134 59 0 116 3 rplT Large ribosomal subunit protein bL20 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B4U9B9 5.38e-41 134 65 0 104 3 rplT Large ribosomal subunit protein bL20 Hydrogenobaculum sp. (strain Y04AAS1)
A5CCZ4 5.73e-41 134 56 0 118 3 rplT Large ribosomal subunit protein bL20 Orientia tsutsugamushi (strain Boryong)
A5US40 6.67e-41 134 67 0 117 3 rplT Large ribosomal subunit protein bL20 Roseiflexus sp. (strain RS-1)
A4FKE3 7.27e-41 134 57 0 118 3 rplT Large ribosomal subunit protein bL20 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B1M6P4 7.79e-41 134 60 0 106 3 rplT Large ribosomal subunit protein bL20 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A0PP60 8.7e-41 134 58 0 118 3 rplT Large ribosomal subunit protein bL20 Mycobacterium ulcerans (strain Agy99)
Q1B7P8 9.49e-41 134 60 0 118 3 rplT Large ribosomal subunit protein bL20 Mycobacterium sp. (strain MCS)
A1UHA9 9.49e-41 134 60 0 118 3 rplT Large ribosomal subunit protein bL20 Mycobacterium sp. (strain KMS)
A3Q0U6 9.49e-41 134 60 0 118 3 rplT Large ribosomal subunit protein bL20 Mycobacterium sp. (strain JLS)
Q4JW09 9.97e-41 134 56 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium jeikeium (strain K411)
B2GDB3 1.05e-40 134 57 0 115 3 rplT Large ribosomal subunit protein bL20 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C3PGJ7 1.19e-40 134 59 0 118 3 rplT Large ribosomal subunit protein bL20 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B2HR14 1.22e-40 134 58 0 118 3 rplT Large ribosomal subunit protein bL20 Mycobacterium marinum (strain ATCC BAA-535 / M)
A1TAC3 1.26e-40 134 59 0 118 3 rplT Large ribosomal subunit protein bL20 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B0SKZ5 1.29e-40 134 56 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCH2 1.29e-40 134 56 0 116 3 rplT Large ribosomal subunit protein bL20 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q4A5F6 1.29e-40 133 58 0 115 3 rplT Large ribosomal subunit protein bL20 Mycoplasmopsis synoviae (strain 53)
B9KLE1 1.36e-40 134 62 1 109 3 rplT Large ribosomal subunit protein bL20 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5M3 1.36e-40 134 62 1 109 3 rplT Large ribosomal subunit protein bL20 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGR0 1.36e-40 134 62 1 109 3 rplT Large ribosomal subunit protein bL20 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A5CWF6 1.46e-40 133 74 0 118 3 rplT Large ribosomal subunit protein bL20 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2GAJ0 1.47e-40 133 61 0 110 3 rplT Large ribosomal subunit protein bL20 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B9M521 1.5e-40 133 59 0 114 3 rplT Large ribosomal subunit protein bL20 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B0TEV4 1.56e-40 133 58 1 117 3 rplT Large ribosomal subunit protein bL20 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A6LTR5 1.65e-40 133 56 0 117 3 rplT Large ribosomal subunit protein bL20 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_08680
Feature type CDS
Gene rplT
Product 50S ribosomal protein L20
Location 213595 - 213951 (strand: 1)
Length 357 (nucleotides) / 118 (amino acids)
In genomic island -

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1845
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00453 Ribosomal protein L20

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0292 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L20

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02887 large subunit ribosomal protein L20 Ribosome -

Protein Sequence

MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFTALVEKAKGALA

Flanking regions ( +/- flanking 50bp)

ATACGCATAAGCAAGTTTTTTAGCAAAGTTTACGACTTTAGGAGATTAGTATGGCTCGTGTAAAACGTGGTGTCATTGCTCGCGCACGTCACAAAAAAATTCTGAAACAAGCGAAAGGTTACTACGGTGCCCGTTCGCGCGTTTATCGTGTTGCCTTCCAGGCAGTAATCAAAGCTGGCCAGTATGCTTACCGTGACCGTCGTCAGCGTAAGCGTCAGTTCCGTCAGCTGTGGATTGCACGTATCAACGCAGCAGCTCGTCAGAATGGTCTGTCTTACAGCCGTTTCATCAACGGTCTGAAAAAGGCATCCATCGAAATCGATCGTAAGATCTTAGCCGATATCGCTGTATTCGATAAAGCCGCATTTACTGCGCTGGTCGAAAAAGCAAAAGGCGCTCTGGCGTAATTGTTCAGACAGAAGAGGGAGCTTGCTCCCTCTTTTGCTATCCGGCAGAA