Homologs in group_794

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03725 FBDBKF_03725 100.0 Morganella morganii S1 hyfE hydrogenase 4 membrane subunit
NLDBIP_07135 NLDBIP_07135 100.0 Morganella morganii S4 hyfE hydrogenase 4 membrane subunit
LHKJJB_06670 LHKJJB_06670 100.0 Morganella morganii S3 hyfE hydrogenase 4 membrane subunit
HKOGLL_04260 HKOGLL_04260 100.0 Morganella morganii S5 hyfE hydrogenase 4 membrane subunit
F4V73_RS11145 F4V73_RS11145 97.7 Morganella psychrotolerans hyfE hydrogenase 4 membrane subunit
PMI_RS12480 PMI_RS12480 85.6 Proteus mirabilis HI4320 hyfE hydrogenase 4 membrane subunit

Distribution of the homologs in the orthogroup group_794

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_794

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEW3 5.87e-92 271 68 0 216 3 hyfE Hydrogenase-4 component E Shigella flexneri
P0AEW1 5.87e-92 271 68 0 216 1 hyfE Hydrogenase-4 component E Escherichia coli (strain K12)
P0AEW2 5.87e-92 271 68 0 216 3 hyfE Hydrogenase-4 component E Escherichia coli O157:H7
P64682 7.32e-07 51 31 0 80 4 BQ2027_MB0088 Uncharacterized protein Mb0088 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WM75 7.32e-07 51 31 0 80 4 Rv0085 Uncharacterized protein Rv0085 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WM74 7.32e-07 51 31 0 80 4 MT0092 Uncharacterized protein MT0092 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_06810
Feature type CDS
Gene hyfE
Product hydrogenase 4 membrane subunit
Location 98689 - 99339 (strand: 1)
Length 651 (nucleotides) / 216 (amino acids)

Contig

Accession ZDB_216
Length 269970 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_794
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00420 NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4237 Energy production and conversion (C) C Hydrogenase-4 membrane subunit HyfE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12140 hydrogenase-4 component E [EC:1.-.-.-] - -

Protein Sequence

MTGSIIVNNLAGLMMITSLLVIGAKRPVASCWFYALQSLVLVAIFATLSQTLDAPQLGMWAITAFATKVVLVPLIMGYAFRKLSDPTANGGVISPAWLMLAAAVIVVLCWFVVEPVKLPMVADLKPALAVSLGHFMLGLLCIVTQRNILKQAFGYCLMENGSHLTLALLAYKAPELVEIGIATDAIFAVIIMAVLARKIYRTLNTLNVDQLTALKG

Flanking regions ( +/- flanking 50bp)

TCTGTTCAAGTGTTATCGCCGTCATCTGGCTCGGTTAAGGGAGAGAAAGTATGACTGGTTCCATTATTGTGAACAATCTGGCGGGGCTGATGATGATCACCTCGCTGCTGGTCATCGGGGCGAAGCGCCCGGTGGCTTCCTGCTGGTTCTATGCACTTCAGTCTCTGGTGCTGGTGGCGATTTTCGCCACGTTGTCACAGACACTGGATGCACCGCAGCTGGGCATGTGGGCGATCACCGCCTTCGCGACCAAAGTGGTGCTGGTGCCGCTGATTATGGGCTATGCCTTCCGCAAACTGTCTGATCCGACCGCCAACGGCGGCGTGATAAGCCCGGCCTGGCTGATGCTGGCTGCGGCGGTGATTGTGGTGCTGTGCTGGTTTGTGGTCGAACCGGTGAAACTGCCGATGGTGGCGGATCTGAAACCGGCACTGGCGGTTTCCCTGGGTCACTTTATGCTGGGCTTACTCTGCATTGTGACACAGCGCAACATCCTGAAACAGGCATTCGGTTATTGCCTGATGGAAAACGGATCGCACCTGACACTGGCTCTGCTGGCGTATAAAGCGCCGGAGCTGGTGGAAATCGGTATCGCGACGGACGCCATTTTCGCTGTGATTATCATGGCGGTGCTGGCACGTAAAATCTATCGCACGCTCAACACACTGAACGTGGATCAACTGACCGCGCTGAAGGGGTGATGAGATGAGTCAAACCATGTTGTTAACGTTATTAATGGCAACGCCGCTGG