Homologs in group_886

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04560 FBDBKF_04560 100.0 Morganella morganii S1 hcr NADH oxidoreductase
NLDBIP_06170 NLDBIP_06170 100.0 Morganella morganii S4 hcr NADH oxidoreductase
LHKJJB_03050 LHKJJB_03050 100.0 Morganella morganii S3 hcr NADH oxidoreductase
HKOGLL_06525 HKOGLL_06525 100.0 Morganella morganii S5 hcr NADH oxidoreductase
F4V73_RS09015 F4V73_RS09015 89.3 Morganella psychrotolerans hcr NADH oxidoreductase
PMI_RS10400 PMI_RS10400 66.2 Proteus mirabilis HI4320 hcr NADH oxidoreductase

Distribution of the homologs in the orthogroup group_886

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_886

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75824 6.44e-137 394 58 5 335 1 hcr NADH oxidoreductase HCR Escherichia coli (strain K12)
Q1QYU6 3.68e-45 160 27 6 349 1 bmoB Glycine betaine monooxygenase reductase subunit Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9HTF3 1.16e-38 143 27 6 340 2 gbcB Glycine betaine monooxygenase reductase subunit Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZJB2 1.16e-38 143 27 6 340 2 gbcB Glycine betaine monooxygenase reductase subunit Pseudomonas aeruginosa (strain UCBPP-PA14)
P76081 9.02e-33 127 27 8 336 1 paaE 1,2-phenylacetyl-CoA epoxidase, subunit E Escherichia coli (strain K12)
B6V6V6 2.53e-32 126 27 8 337 1 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Rhodococcus rhodochrous
A0R525 1.15e-28 116 26 8 336 3 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WJ93 1.58e-27 113 26 7 309 1 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJ92 1.58e-27 113 26 7 309 3 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WNE9 1.02e-18 89 27 8 291 1 Rv3230c NADPH oxidoreductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNE8 1.02e-18 89 27 8 291 3 MT3327 NADPH oxidoreductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9UAG7 3.71e-18 87 28 7 220 2 fhbA Flavohemoprotein A Dictyostelium discoideum
Q52186 2.65e-17 84 22 11 338 2 pobB Phenoxybenzoate dioxygenase subunit beta Pseudomonas oleovorans
O24840 3.09e-17 84 23 9 292 3 vanB Vanillate O-demethylase oxidoreductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8ETH0 1.5e-16 83 26 5 215 3 hmp Flavohemoprotein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q05182 2.92e-16 81 24 10 297 2 pht2 Phthalate 4,5-dioxygenase oxygenase reductase subunit Pseudomonas putida
P76254 3.24e-16 81 25 10 327 1 yeaX Carnitine monooxygenase reductase subunit Escherichia coli (strain K12)
Q7UIY1 1.98e-15 80 28 7 222 3 hmp Flavohemoprotein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P49852 6.83e-15 78 24 6 215 2 hmp Flavohemoprotein Bacillus subtilis (strain 168)
P33164 2.3e-14 76 24 9 306 1 ophA1 Phthalate dioxygenase reductase Burkholderia cepacia
Q81FW4 2.4e-14 76 27 9 219 3 hmp Flavohemoprotein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81T23 6.91e-14 75 27 9 219 3 hmp Flavohemoprotein Bacillus anthracis
Q6HLA6 7.04e-14 75 27 9 219 3 hmp Flavohemoprotein Bacillus thuringiensis subsp. konkukian (strain 97-27)
P07771 8.47e-14 74 27 7 208 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P07771 6.57e-07 53 38 1 71 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
H9N291 2.44e-13 74 25 12 316 1 ndmD Oxidoreductase NdmD Pseudomonas putida
Q51603 1.13e-12 71 25 7 206 1 cbdC 2-halobenzoate 1,2-dioxygenase electron transfer component Burkholderia cepacia
Q73B49 1.16e-12 71 27 9 219 3 hmp Flavohemoprotein Bacillus cereus (strain ATCC 10987 / NRS 248)
Q7MH09 1.18e-12 71 27 6 213 3 hmp Flavohemoprotein Vibrio vulnificus (strain YJ016)
Q8DCU2 1.26e-12 71 27 6 213 3 hmp Flavohemoprotein Vibrio vulnificus (strain CMCP6)
Q9AHG2 1.83e-12 70 28 8 252 5 tsaB2 Putative toluene-4-sulfonate monooxygenase system reductase subunit TsaB2 Comamonas testosteroni
Q9RYR5 2.01e-12 70 26 8 215 3 hmp Flavohemoprotein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
O54037 3.93e-12 69 22 8 303 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas putida
P40609 4.02e-12 70 29 8 217 3 hmp Flavohemoprotein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q59MV9 6.83e-12 69 23 5 196 2 YHB1 Flavohemoprotein Candida albicans (strain SC5314 / ATCC MYA-2876)
P94680 7.55e-12 68 28 9 254 1 tsaB1 Toluene-4-sulfonate monooxygenase system reductase subunit TsaB1 Comamonas testosteroni
Q7TTP2 8.86e-12 68 26 5 217 3 hmp Flavohemoprotein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHW5 8.86e-12 68 26 5 217 3 hmp Flavohemoprotein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7TTP0 9.81e-12 68 26 5 217 3 hmp Flavohemoprotein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9FRJ0 1.37e-11 67 31 3 158 1 sce5135 Ferredoxin--NADP reductase B Sorangium cellulosum (strain So ce56)
Q7N215 1.47e-11 68 23 4 213 3 hmp Flavohemoprotein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q54D73 3.09e-11 67 23 8 250 1 fhbB Flavohemoprotein B Dictyostelium discoideum
A0QTU9 4.6e-11 66 23 6 239 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q47266 4.8e-11 67 23 4 212 3 hmp Flavohemoprotein Dickeya dadantii (strain 3937)
Q8ZCR0 6.23e-11 66 23 4 214 3 hmp Flavohemoprotein Yersinia pestis
A7EKT5 8.33e-11 65 23 3 163 3 mcr1 NADH-cytochrome b5 reductase 2 Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q47914 9.34e-11 65 25 10 271 1 pcpD Tetrachlorobenzoquinone reductase Sphingobium chlorophenolicum
Q7WUM8 1.54e-10 65 25 7 223 3 hmp Flavohemoprotein Rhizobium meliloti (strain 1021)
P11035 2.32e-10 65 28 7 200 1 NIA2 Nitrate reductase [NADH] 2 Arabidopsis thaliana
P19734 4.69e-10 63 22 2 204 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)
P26353 5.35e-10 63 26 5 214 2 hmp Flavohemoprotein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KMY3 5.94e-10 63 30 10 221 1 hmp Flavohemoprotein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
F0KFI7 7.32e-10 62 21 10 304 1 yeaX Carnitine monooxygenase reductase subunit Acinetobacter pittii (strain PHEA-2)
Q0SJK8 8.21e-10 63 24 9 248 1 prmB Propane 2-monooxygenase, reductase component Rhodococcus jostii (strain RHA1)
Q0U9W5 8.79e-10 62 23 4 165 3 MCR1 NADH-cytochrome b5 reductase 2 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
O05617 1.03e-09 62 21 7 261 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas sp. (strain HR199 / DSM 7063)
D0C9N8 1.03e-09 62 21 9 323 1 cntB Carnitine monooxygenase reductase subunit Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
Q8Z4M3 1.04e-09 62 25 5 215 3 hmp Flavohemoprotein Salmonella typhi
Q57LF5 1.07e-09 62 25 5 214 3 hmp Flavohemoprotein Salmonella choleraesuis (strain SC-B67)
P12580 2.13e-09 61 23 12 300 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas sp. (strain ATCC 19151)
Q5BG98 3.34e-09 60 24 4 168 3 mcr1 NADH-cytochrome b5 reductase 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8GAZ4 3.71e-09 61 25 6 212 3 hmp Flavohemoprotein Burkholderia sp. (strain TH2)
A6SI59 4.4e-09 60 23 3 163 3 mcr1 NADH-cytochrome b5 reductase 2 Botryotinia fuckeliana (strain B05.10)
Q5PIH6 4.52e-09 60 25 5 215 3 hmp Flavohemoprotein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7SFY2 5.07e-09 60 22 3 170 3 mcr-1 NADH-cytochrome b5 reductase 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P21394 6.26e-09 60 24 4 222 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
P21394 4.19e-06 51 30 2 98 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
Q3C1D2 6.66e-09 60 20 3 211 1 tphA1II Terephthalate 1,2-dioxygenase, reductase component 2 Comamonas sp.
P23312 6.73e-09 60 25 5 140 2 NIA Nitrate reductase [NADH] Spinacia oleracea
E9RFT0 7.66e-09 60 21 4 235 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium goodii
P16081 1.21e-08 60 25 4 127 2 NIA1 Nitrate reductase [NADH] 1 Oryza sativa subsp. japonica
Q9URY5 1.37e-08 59 27 9 248 3 SPAC869.02c Flavohemoprotein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2UFN3 1.42e-08 58 24 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A4QR21 1.55e-08 58 23 4 171 3 MCR1 NADH-cytochrome b5 reductase 2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q9ZNT1 2.07e-08 58 23 5 198 1 CBR1 NADH--cytochrome b5 reductase 1 Arabidopsis thaliana
B0CQN7 2.15e-08 58 23 4 180 3 MCR1.1 NADH-cytochrome b5 reductase 1 Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686)
P39867 2.43e-08 59 26 3 124 2 NIA1 Nitrate reductase [NADH], clone PBNBR1405 Brassica napus
Q7NSD8 2.43e-08 58 27 7 202 3 hmp Flavohemoprotein Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C6LR75 2.82e-08 58 25 10 247 3 hmpA Flavohemoprotein Giardia intestinalis (strain ATCC 50581 / GS clone H7)
A2Q898 2.92e-08 58 24 6 172 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q6D245 4.06e-08 57 23 5 215 3 hmp Flavohemoprotein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3C1E0 4.68e-08 57 19 3 208 1 tphA1I Terephthalate 1,2-dioxygenase, reductase component 1 Comamonas sp.
Q4PGW7 8.12e-08 56 23 4 194 3 CBR1 NADH-cytochrome b5 reductase 1 Ustilago maydis (strain 521 / FGSC 9021)
O52378 8.8e-08 56 21 5 242 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
O52378 0.000143 46 38 0 57 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
Q6BUX2 9.39e-08 56 23 5 180 3 CBR1 NADH-cytochrome b5 reductase 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q9RC40 9.8e-08 56 23 7 220 3 hmp Flavohemoprotein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0DPQ8 1.15e-07 56 22 5 209 1 gcoB Aromatic O-demethylase, reductase subunit Amycolatopsis sp. (strain ATCC 39116 / 75iv2)
Q7WTJ2 1.89e-07 55 21 3 202 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
P68641 2.27e-07 55 25 7 210 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
P68641 1.2e-05 50 32 0 65 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
Q66DP5 2.31e-07 55 25 7 210 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66DP5 1.26e-05 50 32 0 65 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q6LM37 2.56e-07 55 25 6 206 3 hmp Flavohemoprotein Photobacterium profundum (strain SS9)
A1D4H0 3.56e-07 54 26 5 123 3 mcr1 NADH-cytochrome b5 reductase 2 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q52126 4.12e-07 54 20 5 236 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
Q52126 0.001 44 29 0 78 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
P26475 4.38e-07 53 23 8 210 2 asrB Anaerobic sulfite reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4P7Y8 4.91e-07 54 21 5 173 3 MCR1 NADH-cytochrome b5 reductase 2 Ustilago maydis (strain 521 / FGSC 9021)
P39662 5.36e-07 54 25 9 228 1 hmp Flavohemoprotein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P39882 5.92e-07 52 23 3 121 2 NIA Nitrate reductase [NADH] (Fragment) Lotus tetragonolobus
P49102 7.55e-07 54 25 5 147 3 None Nitrate reductase [NADH] 3 Zea mays
Q75C62 7.56e-07 53 20 3 166 3 MCR1 NADH-cytochrome b5 reductase 2 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A5E7U2 8.5e-07 53 20 4 194 3 CBR1 NADH-cytochrome b5 reductase 1 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
O74557 8.78e-07 53 23 5 194 3 cbr1 NADH-cytochrome b5 reductase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q53563 8.79e-07 53 27 3 142 1 mmoC Methane monooxygenase component C Methylosinus trichosporium
A1KSH3 1.44e-06 53 25 9 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JVQ3 1.44e-06 53 25 9 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2A6 1.44e-06 53 25 9 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C (strain 053442)
Q9K0M8 1.47e-06 53 25 9 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A7TNL7 1.52e-06 52 20 5 192 3 CBR1 NADH-cytochrome b5 reductase 1 Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
P27967 1.53e-06 53 24 4 127 3 None Nitrate reductase [NADH] Hordeum vulgare
Q9I0H4 1.6e-06 53 25 7 210 3 hmp Flavohemoprotein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6R1T7 1.61e-06 52 21 4 174 3 MCR1 NADH-cytochrome b5 reductase 2 Ajellomyces capsulatus (strain NAm1 / WU24)
E1F8H4 1.67e-06 53 22 7 250 3 hmpA-2 Flavohemoprotein-2 Giardia intestinalis (strain P15)
Q54NC1 1.83e-06 52 22 6 186 3 cyb5r1 NADH-cytochrome b5 reductase 1 Dictyostelium discoideum
Q5AZB4 1.98e-06 52 22 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A1CRK9 2.42e-06 52 26 3 102 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q1DXN1 2.51e-06 52 22 3 176 3 MCR1 NADH-cytochrome b5 reductase 2 Coccidioides immitis (strain RS)
Q58841 2.61e-06 51 23 13 232 3 pyrK Probable dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P27969 2.94e-06 52 24 4 127 2 None Nitrate reductase [NADH] (Fragment) Hordeum vulgare
Q88PP0 2.96e-06 52 27 6 204 3 hmp Flavohemoprotein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0CY37 3.09e-06 51 21 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9UR35 3.36e-06 51 23 6 202 2 CBR1 NADH-cytochrome b5 reductase 1 Mortierella alpina
A6ZVM6 3.46e-06 51 20 6 188 3 CBR1 NADH-cytochrome b5 reductase 1 Saccharomyces cerevisiae (strain YJM789)
P0ABW3 3.73e-06 47 36 1 65 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli (strain K12)
P0ABW4 3.73e-06 47 36 1 65 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
E1F8Q4 4.01e-06 52 21 7 250 3 hmpA-1 Flavohemoprotein-1 Giardia intestinalis (strain P15)
P39866 4.17e-06 52 26 4 124 3 NIA2 Nitrate reductase [NADH] 2 Phaseolus vulgaris
P11832 4.24e-06 52 25 3 124 1 NIA1 Nitrate reductase [NADH] 1 Arabidopsis thaliana
P39870 5.02e-06 52 28 7 138 2 INR2 Inducible nitrate reductase [NADH] 2 Glycine max
P38626 5.08e-06 50 20 7 229 1 CBR1 NADH-cytochrome b5 reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q89A28 5.7e-06 50 22 8 198 3 fpr Flavodoxin/ferredoxin--NADP reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8FF30 6.33e-06 51 23 5 215 3 hmp Flavohemoprotein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P81372 6.65e-06 47 32 0 64 1 None Ferredoxin-A Alocasia macrorrhizos
Q87F90 6.81e-06 51 21 3 190 3 hmp Flavohemoprotein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P43100 7.82e-06 51 23 5 206 3 NIA Nitrate reductase [NADPH] Beauveria bassiana
P00239 9.96e-06 47 33 0 74 1 None Ferredoxin-1 Dunaliella salina
Q7ABK6 1.14e-05 50 23 5 215 3 hmp Flavohemoprotein Escherichia coli O157:H7
Q04516 1.2e-05 50 21 6 188 1 AIM33 Uncharacterized oxidoreductase AIM33 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
W7MSJ7 1.23e-05 50 22 11 298 2 FVEG_12641 Reductase FVEG_12641 Gibberella moniliformis (strain M3125 / FGSC 7600)
A7IPX7 1.23e-05 50 23 6 236 1 xamoF Alkene monooxygenase system, ferredoxin--NAD(+) reductase component Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q8IED5 1.23e-05 48 22 0 99 1 FD Ferredoxin, apicoplast Plasmodium falciparum (isolate 3D7)
Q9L6L9 1.23e-05 49 23 10 246 1 fre NAD(P)H-flavin reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P24232 1.24e-05 50 23 5 215 1 hmp Flavohemoprotein Escherichia coli (strain K12)
Q9PH91 1.33e-05 50 21 3 190 3 hmp Flavohemoprotein Xylella fastidiosa (strain 9a5c)
Q2UKB8 1.4e-05 49 21 4 164 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P54233 1.49e-05 50 28 7 138 2 INR1 Inducible nitrate reductase [NADH] 1 Glycine max
Q9X406 1.6e-05 49 21 5 241 1 msmD Putative methanesulfonate monooxygenase ferredoxin reductase subunit Methylosulfonomonas methylovora
Q9C7Y4 1.77e-05 48 33 0 65 2 FDC2 Ferredoxin C 2, chloroplastic Arabidopsis thaliana
P15788 1.83e-05 46 32 0 62 1 PCC7418_2938 Ferredoxin Halothece sp. (strain PCC 7418)
E2RTZ4 1.99e-05 49 21 9 251 1 hmpA Flavohemoprotein Giardia intestinalis (strain ATCC 50803 / WB clone C6)
P17571 2.01e-05 50 24 4 127 1 NNR1 Nitrate reductase [NADH] 1 (Fragment) Zea mays
Q768T4 2.23e-05 49 19 4 232 1 prmB Propane 2-monooxygenase, reductase component Gordonia sp. (strain TY-5)
P09735 2.4e-05 45 31 1 73 1 None Ferredoxin Marchantia polymorpha
A1DHW1 2.46e-05 48 20 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q7C0F9 2.51e-05 49 23 5 215 3 hmp Flavohemoprotein Shigella flexneri
P83291 2.67e-05 48 23 5 170 1 CBR2 NADH-cytochrome b5 reductase-like protein Arabidopsis thaliana
P00234 2.75e-05 45 37 0 62 1 None Ferredoxin-1 Equisetum telmateia
P00230 2.81e-05 45 30 0 83 1 None Ferredoxin-1 Phytolacca acinosa
P45154 2.89e-05 45 29 2 67 4 HI_1309 Uncharacterized ferredoxin-like protein HI_1309 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1C7E9 2.95e-05 48 22 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q3KKV3 2.95e-05 49 22 9 219 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
P00235 2.97e-05 45 37 0 62 1 None Ferredoxin-1 Equisetum arvense
Q0CRD8 3e-05 48 24 4 164 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P27968 3.32e-05 49 26 4 123 2 NAR-7 Nitrate reductase [NAD(P)H] Hordeum vulgare
P22868 3.54e-05 48 23 1 128 1 mmoC Methane monooxygenase component C Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P39868 3.94e-05 49 24 3 124 2 NIA2 Nitrate reductase [NADH], clone PBNBR1412 Brassica napus
Q3MHW9 3.99e-05 48 26 4 122 2 CYB5R1 NADH-cytochrome b5 reductase 1 Bos taurus
P83522 4.09e-05 45 29 0 71 1 None Ferredoxin Hordeum vulgare
P00248 4.15e-05 45 32 0 64 1 petF Ferredoxin Mastigocladus laminosus
P39676 4.26e-05 48 24 7 217 1 YHB1 Flavohemoprotein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q4X0B5 4.27e-05 48 20 4 183 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O85675 4.41e-05 48 23 6 204 1 antC Anthranilate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P00229 4.86e-05 45 30 0 83 1 None Ferredoxin-1 Phytolacca americana
P08451 5.01e-05 45 38 0 55 3 petF2 Ferredoxin-2 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P43129 5.02e-05 47 22 6 231 3 fre NAD(P)H-flavin reductase Photorhabdus luminescens
P11605 5.13e-05 48 26 5 125 3 NIA1 Nitrate reductase [NADH] 1 Nicotiana tabacum
Q9DB73 5.13e-05 48 25 5 127 1 Cyb5r1 NADH-cytochrome b5 reductase 1 Mus musculus
Q45692 6.02e-05 48 38 0 57 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
Q45692 0.000189 46 22 3 169 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
Q5EB81 7.3e-05 47 25 5 127 2 Cyb5r1 NADH-cytochrome b5 reductase 1 Rattus norvegicus
P00220 7.48e-05 44 28 0 74 1 None Ferredoxin Medicago sativa
O84745 8.5e-05 47 22 9 219 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q1Q7Z7 8.71e-05 47 23 8 217 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
P0A3D1 9.12e-05 44 29 1 77 3 petF1 Ferredoxin-1 Thermostichus vulcanus
P0A3C9 9.12e-05 44 29 1 77 1 petF1 Ferredoxin-1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A3D0 9.12e-05 44 29 1 77 3 petF1 Ferredoxin-1 Synechococcus elongatus
P00232 9.39e-05 44 30 0 78 1 None Ferredoxin-2 Phytolacca acinosa
Q51577 9.6e-05 44 30 0 62 1 petF1 Ferredoxin-1 Leptolyngbya boryana
A4R935 9.87e-05 47 21 4 184 3 CBR1 NADH-cytochrome b5 reductase 1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q8PW55 0.000101 47 23 12 236 3 pyrK Probable dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P14936 0.000102 44 29 0 71 1 None Ferredoxin, root R-B1 Raphanus sativus
Q9UHQ9 0.000102 47 25 5 127 1 CYB5R1 NADH-cytochrome b5 reductase 1 Homo sapiens
P56408 0.000102 43 31 0 73 1 None Ferredoxin Scenedesmus fuscus
P08509 0.000103 47 25 5 125 2 NIA2 Nitrate reductase [NADH] 2 Nicotiana tabacum
P0A3C8 0.000112 44 33 0 63 1 petF Ferredoxin-1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A3C7 0.000112 44 33 0 63 1 petF Ferredoxin-1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A3GF86 0.000115 47 20 4 167 3 CBR1 NADH-cytochrome b5 reductase 1 Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
P00253 0.000117 43 33 0 63 1 None Ferredoxin Desmonostoc muscorum
P23101 0.000127 47 22 8 236 3 xylZ Toluate 1,2-dioxygenase electron transfer component Pseudomonas putida
P00255 0.000141 43 30 0 62 1 None Ferredoxin Thermostichus lividus
P83583 0.000144 43 25 1 81 1 None Ferredoxin Solanum lyratum
P39865 0.000148 47 27 7 138 3 NIA1 Nitrate reductase [NADH] 1 Phaseolus vulgaris
P00247 0.000152 43 35 0 54 1 None Ferredoxin Chlorogloeopsis fritschii
A7TM72 0.000152 46 19 5 172 3 MCR1B NADH-cytochrome b5 reductase 2-B Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
P00245 0.000211 43 33 1 69 1 None Ferredoxin Limnospira maxima
O04683 0.000217 44 28 0 83 2 None Ferredoxin-1, chloroplastic Mesembryanthemum crystallinum
Q0J8M2 0.000236 44 29 0 71 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. japonica
A2YQD9 0.000236 44 29 0 71 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. indica
Q9TLW0 0.00024 43 30 0 63 3 petF Ferredoxin Cyanidium caldarium
P0AEN1 0.000254 45 22 10 248 1 fre NAD(P)H-flavin reductase Escherichia coli (strain K12)
P0AEN2 0.000254 45 22 10 248 3 fre NAD(P)H-flavin reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEN3 0.000254 45 22 10 248 3 fre NAD(P)H-flavin reductase Escherichia coli O157:H7
P00231 0.000277 43 30 0 78 1 None Ferredoxin-2 Phytolacca americana
P00228 0.000297 43 28 0 71 1 PETF Ferredoxin, chloroplastic Triticum aestivum
P31965 0.000311 42 37 0 51 3 petF Ferredoxin-1 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P00252 0.000354 42 32 0 62 1 None Ferredoxin-1 Desmonostoc muscorum
Q5UZ63 0.000358 43 40 0 55 3 fer2 Ferredoxin-2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P00233 0.000362 42 27 0 74 1 None Ferredoxin Gleichenia japonica
Q6FLT3 0.000363 45 21 5 165 3 CBR1 NADH-cytochrome b5 reductase 1 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q4WJW8 0.000382 45 25 5 123 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P00221 0.000401 43 27 0 74 1 PETF Ferredoxin-1, chloroplastic Spinacia oleracea
P00225 0.000404 42 27 0 72 1 None Ferredoxin Leucaena leucocephala
P00254 0.000418 42 33 0 62 1 petF1 Ferredoxin-1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7RXL1 0.000513 45 20 4 184 3 cbr1 NADH-cytochrome b5 reductase 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P85121 0.000557 42 27 0 72 1 None Ferredoxin Panax ginseng
Q9Z723 0.000637 45 30 2 73 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia pneumoniae
Q605A0 0.000657 45 32 2 77 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P13106 0.000742 41 27 1 77 1 None Ferredoxin Bumilleriopsis filiformis
A6VLY1 0.000766 44 23 7 207 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P00222 0.000857 41 28 0 73 1 None Ferredoxin Colocasia esculenta
Q9L6V3 0.001 43 20 10 258 1 fpr Flavodoxin/ferredoxin--NADP reductase Rhodobacter capsulatus
P00236 0.001 41 39 1 51 1 None Ferredoxin-2 Equisetum telmateia
P00226 0.001 41 27 0 74 1 None Ferredoxin Sambucus nigra

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05850
Feature type CDS
Gene hcr
Product NADH oxidoreductase
Location 166362 - 167369 (strand: -1)
Length 1008 (nucleotides) / 335 (amino acids)

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_886
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain
PF00175 Oxidoreductase NAD-binding domain
PF00970 Oxidoreductase FAD-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1018 Energy production and conversion (C) C Flavodoxin/ferredoxin--NADP reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11933 NADH oxidoreductase Hcr [EC:1.-.-.-] - -

Protein Sequence

MTMPTSLCPNRMQVHSVRQETPDVWTINLINHDFYQYHAGQYALVSIRNSDETLRAYTLSSTPGLSPFLSLTVRRLDDGQGSGWLTGEVKPGDYLWLSDAQGEFTCDARPAERYLMLAAGCGVTPVMSMTRWILHRQPESQVTVIFNVRDKQQVIFAQEWQQLLTAFPARLRLILMVENSDETDELLSGRLSEEKLKVLIPDIAQHTVMTCGPAPYMKNVQTFCQALNVDPGSFFMERFGPEPEAEAGEQMVTMTIQSPLRQVKVPVGMTLLAAMEANSVPVMAACRAGVCGSCKTRVRSGEYTTTSTMTLTPEEIEQGYVLACSCQIQGNVELA

Flanking regions ( +/- flanking 50bp)

CACCGGAGAAGGCGGTCACGCCTTCTCCGGCACGGAGTCAGGAGAGCCCGATGACAATGCCGACGTCTTTATGTCCGAACCGCATGCAGGTCCATTCTGTCAGGCAGGAAACCCCGGATGTGTGGACTATCAATCTGATTAACCACGATTTTTATCAGTATCACGCAGGGCAGTATGCGCTGGTGAGTATCCGCAACAGTGATGAGACACTGCGTGCTTATACCTTATCCTCCACACCGGGACTGAGCCCGTTCCTGAGCCTGACGGTGCGCCGTCTGGATGACGGACAGGGTTCCGGCTGGCTGACCGGTGAGGTGAAACCGGGTGATTACCTGTGGCTGTCTGATGCACAGGGTGAGTTTACCTGTGATGCCCGTCCGGCAGAGCGCTATCTGATGCTGGCCGCCGGTTGCGGCGTGACACCGGTGATGTCGATGACCCGCTGGATCCTGCACCGTCAGCCGGAAAGTCAGGTGACGGTGATTTTCAACGTGCGTGATAAACAGCAGGTGATTTTTGCTCAGGAATGGCAGCAGTTGCTGACTGCATTCCCGGCCCGTCTGCGCCTGATCCTGATGGTGGAAAACAGTGATGAGACGGATGAATTGTTATCCGGCCGCCTGTCAGAGGAAAAACTGAAGGTGCTGATCCCGGATATCGCACAGCATACGGTGATGACCTGTGGTCCGGCGCCGTATATGAAGAATGTGCAGACATTCTGTCAGGCACTGAATGTGGATCCGGGCAGCTTCTTTATGGAGCGTTTCGGGCCGGAGCCGGAAGCGGAAGCCGGAGAGCAGATGGTCACCATGACCATTCAGTCCCCGCTGCGTCAGGTGAAAGTGCCTGTCGGTATGACCCTGCTGGCGGCGATGGAAGCGAACAGTGTGCCGGTAATGGCGGCATGCCGCGCCGGTGTCTGCGGCAGTTGTAAAACCCGCGTCCGCAGCGGTGAATATACCACCACCAGCACAATGACGCTGACCCCGGAAGAGATTGAACAGGGTTATGTTCTGGCGTGCAGCTGTCAGATTCAGGGCAATGTTGAATTAGCCTGATTGAGAATCATTCTGTATAATTGCAAAAAAGCGCCGTTTTCAGCGGCGCT