Homologs in group_955

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04560 FBDBKF_04560 66.2 Morganella morganii S1 hcr NADH oxidoreductase
EHELCC_05850 EHELCC_05850 66.2 Morganella morganii S2 hcr NADH oxidoreductase
NLDBIP_06170 NLDBIP_06170 66.2 Morganella morganii S4 hcr NADH oxidoreductase
LHKJJB_03050 LHKJJB_03050 66.2 Morganella morganii S3 hcr NADH oxidoreductase
HKOGLL_06525 HKOGLL_06525 66.2 Morganella morganii S5 hcr NADH oxidoreductase
F4V73_RS09015 F4V73_RS09015 65.3 Morganella psychrotolerans hcr NADH oxidoreductase

Distribution of the homologs in the orthogroup group_955

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_955

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75824 1.7e-126 368 55 5 334 1 hcr NADH oxidoreductase HCR Escherichia coli (strain K12)
Q1QYU6 1.94e-43 156 28 5 330 1 bmoB Glycine betaine monooxygenase reductase subunit Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9HTF3 1.78e-39 145 27 5 335 2 gbcB Glycine betaine monooxygenase reductase subunit Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZJB2 1.78e-39 145 27 5 335 2 gbcB Glycine betaine monooxygenase reductase subunit Pseudomonas aeruginosa (strain UCBPP-PA14)
P76081 2.11e-34 132 27 11 346 1 paaE 1,2-phenylacetyl-CoA epoxidase, subunit E Escherichia coli (strain K12)
B6V6V6 1.02e-28 116 25 7 314 1 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Rhodococcus rhodochrous
A0R525 1.84e-26 110 25 8 342 3 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WJ93 2.27e-24 105 26 7 308 1 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJ92 2.27e-24 105 26 7 308 3 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WNE9 6.68e-24 103 27 8 298 1 Rv3230c NADPH oxidoreductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNE8 6.68e-24 103 27 8 298 3 MT3327 NADPH oxidoreductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P76254 4.38e-20 92 26 9 325 1 yeaX Carnitine monooxygenase reductase subunit Escherichia coli (strain K12)
Q05182 1.77e-18 87 26 9 286 2 pht2 Phthalate 4,5-dioxygenase oxygenase reductase subunit Pseudomonas putida
O24840 1.18e-16 82 22 7 292 3 vanB Vanillate O-demethylase oxidoreductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9UAG7 2.28e-16 82 26 6 218 2 fhbA Flavohemoprotein A Dictyostelium discoideum
Q54D73 4.7e-15 79 25 5 259 1 fhbB Flavohemoprotein B Dictyostelium discoideum
Q8ETH0 7.8e-15 78 25 7 216 3 hmp Flavohemoprotein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
H9N291 1.19e-14 78 23 8 316 1 ndmD Oxidoreductase NdmD Pseudomonas putida
P40609 3.64e-14 76 29 8 214 3 hmp Flavohemoprotein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P12580 7.59e-14 74 23 8 297 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas sp. (strain ATCC 19151)
Q7N215 1.09e-13 74 24 4 210 3 hmp Flavohemoprotein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P49852 1.22e-13 74 23 5 211 2 hmp Flavohemoprotein Bacillus subtilis (strain 168)
D0C9N8 1.3e-13 73 21 8 320 1 cntB Carnitine monooxygenase reductase subunit Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
Q7TTP2 1.7e-13 74 26 6 216 3 hmp Flavohemoprotein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHW5 1.7e-13 74 26 6 216 3 hmp Flavohemoprotein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7TTP0 1.81e-13 74 26 6 216 3 hmp Flavohemoprotein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8GAZ4 3.53e-13 73 27 5 210 3 hmp Flavohemoprotein Burkholderia sp. (strain TH2)
O54037 4.1e-13 72 22 6 293 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas putida
Q47266 4.83e-13 72 25 4 210 3 hmp Flavohemoprotein Dickeya dadantii (strain 3937)
A0QTU9 5.12e-13 72 24 6 238 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9RYR5 5.36e-13 72 25 7 212 3 hmp Flavohemoprotein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
F0KFI7 6.1e-13 71 21 8 318 1 yeaX Carnitine monooxygenase reductase subunit Acinetobacter pittii (strain PHEA-2)
P19734 2.93e-12 70 25 4 208 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)
Q3C1E0 3.17e-12 70 23 5 210 1 tphA1I Terephthalate 1,2-dioxygenase, reductase component 1 Comamonas sp.
Q73B49 3.67e-12 70 26 7 215 3 hmp Flavohemoprotein Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9I0H4 7.62e-12 69 26 8 237 3 hmp Flavohemoprotein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NSD8 7.84e-12 69 27 8 222 3 hmp Flavohemoprotein Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8DCU2 9.11e-12 68 26 6 211 3 hmp Flavohemoprotein Vibrio vulnificus (strain CMCP6)
Q7MH09 9.28e-12 68 26 6 211 3 hmp Flavohemoprotein Vibrio vulnificus (strain YJ016)
Q3C1D2 1.26e-11 68 22 5 210 1 tphA1II Terephthalate 1,2-dioxygenase, reductase component 2 Comamonas sp.
Q81T23 1.65e-11 68 26 7 215 3 hmp Flavohemoprotein Bacillus anthracis
Q6HLA6 1.86e-11 68 26 7 215 3 hmp Flavohemoprotein Bacillus thuringiensis subsp. konkukian (strain 97-27)
A9FRJ0 1.94e-11 66 26 7 240 1 sce5135 Ferredoxin--NADP reductase B Sorangium cellulosum (strain So ce56)
E9RFT0 2.04e-11 67 22 5 236 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium goodii
P33164 2.38e-11 67 21 10 330 1 ophA1 Phthalate dioxygenase reductase Burkholderia cepacia
Q8Z4M3 3.28e-11 67 27 6 212 3 hmp Flavohemoprotein Salmonella typhi
Q7UIY1 4.12e-11 67 26 7 218 3 hmp Flavohemoprotein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q57LF5 4.16e-11 67 27 6 212 3 hmp Flavohemoprotein Salmonella choleraesuis (strain SC-B67)
P26353 4.82e-11 67 27 6 212 2 hmp Flavohemoprotein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q81FW4 6.22e-11 66 25 7 215 3 hmp Flavohemoprotein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P24232 6.95e-11 66 27 6 212 1 hmp Flavohemoprotein Escherichia coli (strain K12)
Q5PIH6 9.83e-11 65 26 6 212 3 hmp Flavohemoprotein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7WUM8 1.36e-10 65 26 9 217 3 hmp Flavohemoprotein Rhizobium meliloti (strain 1021)
P07771 1.48e-10 65 25 5 206 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P07771 1.95e-06 52 36 1 73 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q52126 1.75e-10 64 21 4 233 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
Q52126 0.000603 44 32 0 64 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
Q8ZCR0 1.84e-10 65 25 4 212 3 hmp Flavohemoprotein Yersinia pestis
O05617 2.39e-10 64 22 9 286 3 vanB Vanillate O-demethylase oxidoreductase Pseudomonas sp. (strain HR199 / DSM 7063)
Q7C0F9 2.63e-10 64 27 6 212 3 hmp Flavohemoprotein Shigella flexneri
Q7ABK6 2.63e-10 64 27 6 212 3 hmp Flavohemoprotein Escherichia coli O157:H7
W7MSJ7 2.64e-10 65 24 15 321 2 FVEG_12641 Reductase FVEG_12641 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q0SJK8 3.58e-10 63 20 5 236 1 prmB Propane 2-monooxygenase, reductase component Rhodococcus jostii (strain RHA1)
A7EKT5 3.63e-10 63 26 4 163 3 mcr1 NADH-cytochrome b5 reductase 2 Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q9RC40 4.44e-10 63 25 9 219 3 hmp Flavohemoprotein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7WTJ2 5.54e-10 63 23 4 208 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
Q8FF30 7.57e-10 63 27 6 212 3 hmp Flavohemoprotein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6SI59 1.11e-09 62 25 4 163 3 mcr1 NADH-cytochrome b5 reductase 2 Botryotinia fuckeliana (strain B05.10)
Q9AHG2 1.31e-09 62 25 8 254 5 tsaB2 Putative toluene-4-sulfonate monooxygenase system reductase subunit TsaB2 Comamonas testosteroni
Q6D245 1.91e-09 62 22 4 210 3 hmp Flavohemoprotein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LM37 3.28e-09 61 26 6 211 3 hmp Flavohemoprotein Photobacterium profundum (strain SS9)
Q8U2E4 3.82e-09 60 26 11 241 1 hydG Sulfhydrogenase 1 subunit gamma Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
G8FRC6 3.83e-09 60 23 11 318 1 mdpK Tert-butanol monooxygenase / tert-amyl alcohol desaturase reductase subunit Aquincola tertiaricarbonis
P21394 3.87e-09 60 24 5 213 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
P21394 9.62e-06 50 32 2 84 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
Q47914 4.1e-09 60 23 10 265 1 pcpD Tetrachlorobenzoquinone reductase Sphingobium chlorophenolicum
Q54NC1 5.11e-09 60 23 3 196 3 cyb5r1 NADH-cytochrome b5 reductase 1 Dictyostelium discoideum
P0DPQ8 5.45e-09 60 21 5 207 1 gcoB Aromatic O-demethylase, reductase subunit Amycolatopsis sp. (strain ATCC 39116 / 75iv2)
P0DPQ8 2.98e-05 48 34 1 76 1 gcoB Aromatic O-demethylase, reductase subunit Amycolatopsis sp. (strain ATCC 39116 / 75iv2)
Q9KMY3 6.23e-09 60 26 9 211 1 hmp Flavohemoprotein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q52186 6.74e-09 60 22 11 304 2 pobB Phenoxybenzoate dioxygenase subunit beta Pseudomonas oleovorans
Q66DP5 6.95e-09 60 24 7 207 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66DP5 2.4e-06 52 30 0 65 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
P68641 7.01e-09 60 24 7 207 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
P68641 2.4e-06 52 30 0 65 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
P94680 8.31e-09 59 24 9 256 1 tsaB1 Toluene-4-sulfonate monooxygenase system reductase subunit TsaB1 Comamonas testosteroni
C6LR75 1.28e-08 59 24 7 256 3 hmpA Flavohemoprotein Giardia intestinalis (strain ATCC 50581 / GS clone H7)
Q7SFY2 1.3e-08 59 22 4 174 3 mcr-1 NADH-cytochrome b5 reductase 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q88PP0 1.55e-08 59 25 9 228 3 hmp Flavohemoprotein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P22868 1.71e-08 58 21 4 207 1 mmoC Methane monooxygenase component C Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4QR21 2.41e-08 58 27 6 169 3 MCR1 NADH-cytochrome b5 reductase 2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P14938 3.16e-08 53 39 0 64 1 None Ferredoxin, leaf L-A Raphanus sativus
P39662 3.45e-08 58 25 9 222 1 hmp Flavohemoprotein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q53563 4.27e-08 57 26 3 134 1 mmoC Methane monooxygenase component C Methylosinus trichosporium
P00233 6.97e-08 53 33 0 74 1 None Ferredoxin Gleichenia japonica
Q1DXN1 7.06e-08 57 25 4 169 3 MCR1 NADH-cytochrome b5 reductase 2 Coccidioides immitis (strain RS)
P00248 7.37e-08 53 36 0 71 1 petF Ferredoxin Mastigocladus laminosus
P0A3C8 7.51e-08 53 38 0 71 1 petF Ferredoxin-1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A3C7 7.51e-08 53 38 0 71 1 petF Ferredoxin-1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P00227 7.72e-08 53 39 0 64 1 None Ferredoxin Brassica napus
P00253 8.21e-08 53 38 0 71 1 None Ferredoxin Desmonostoc muscorum
P83583 9.07e-08 52 36 0 63 1 None Ferredoxin Solanum lyratum
P15789 9.71e-08 52 36 0 69 1 PETF Ferredoxin Cyanidium caldarium
P00254 1.07e-07 52 37 0 72 1 petF1 Ferredoxin-1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q51603 1.09e-07 56 25 7 208 1 cbdC 2-halobenzoate 1,2-dioxygenase electron transfer component Burkholderia cepacia
A2Q898 1.15e-07 56 24 4 168 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P0A3D3 1.23e-07 52 36 0 72 1 petF1 Ferredoxin-1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P0A3D2 1.23e-07 52 36 0 72 3 petF Ferredoxin-1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O52378 1.64e-07 55 20 3 225 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
O52378 4.72e-05 48 34 0 70 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
P00252 2.18e-07 51 34 0 72 1 None Ferredoxin-1 Desmonostoc muscorum
Q4P7Y8 2.3e-07 55 22 4 174 3 MCR1 NADH-cytochrome b5 reductase 2 Ustilago maydis (strain 521 / FGSC 9021)
P83522 4.05e-07 50 32 0 71 1 None Ferredoxin Hordeum vulgare
P00225 4.24e-07 50 33 0 72 1 None Ferredoxin Leucaena leucocephala
Q0J8M2 4.58e-07 52 33 0 71 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. japonica
A2YQD9 4.58e-07 52 33 0 71 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. indica
P0ABW3 4.94e-07 50 40 1 65 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli (strain K12)
P0ABW4 4.94e-07 50 40 1 65 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P00234 5.13e-07 50 37 0 62 1 None Ferredoxin-1 Equisetum telmateia
P00235 5.55e-07 50 37 0 62 1 None Ferredoxin-1 Equisetum arvense
A7IPX7 5.7e-07 53 21 5 205 1 xamoF Alkene monooxygenase system, ferredoxin--NAD(+) reductase component Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q0U9W5 5.74e-07 54 23 4 164 3 MCR1 NADH-cytochrome b5 reductase 2 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A1KSH3 6.63e-07 54 24 10 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JVQ3 6.63e-07 54 24 10 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2A6 6.63e-07 54 24 10 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C (strain 053442)
Q2HG02 6.83e-07 53 25 6 176 3 MCR1 NADH-cytochrome b5 reductase 2 Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
O80429 6.87e-07 51 33 0 71 1 FDX2 Ferredoxin-2, chloroplastic Zea mays
Q9K0M8 7e-07 54 24 10 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5BG98 7.15e-07 53 23 5 172 3 mcr1 NADH-cytochrome b5 reductase 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6FUX5 7.23e-07 53 24 6 199 3 MCR1 NADH-cytochrome b5 reductase 2 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P00244 7.53e-07 50 34 0 72 1 None Ferredoxin-1 Aphanizomenon flos-aquae
O04683 7.81e-07 51 31 0 86 2 None Ferredoxin-1, chloroplastic Mesembryanthemum crystallinum
Q51577 7.86e-07 50 37 0 69 1 petF1 Ferredoxin-1 Leptolyngbya boryana
P27787 8.02e-07 51 35 0 71 1 FDX1 Ferredoxin-1, chloroplastic Zea mays
Q5F6X5 8.76e-07 53 24 10 226 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2UKB8 8.92e-07 53 23 4 163 3 mcr1 NADH-cytochrome b5 reductase 2 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
O84745 9.6e-07 53 23 7 219 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9TLW0 1.07e-06 49 33 0 63 3 petF Ferredoxin Cyanidium caldarium
E7FHW8 1.23e-06 52 21 7 227 1 shyC Sulfhydrogenase 2 subunit gamma Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P09735 1.51e-06 49 32 1 83 1 None Ferredoxin Marchantia polymorpha
Q4PGW7 2.02e-06 52 27 5 177 3 CBR1 NADH-cytochrome b5 reductase 1 Ustilago maydis (strain 521 / FGSC 9021)
P00230 2.05e-06 48 30 0 84 1 None Ferredoxin-1 Phytolacca acinosa
P23101 2.33e-06 52 27 7 207 3 xylZ Toluate 1,2-dioxygenase electron transfer component Pseudomonas putida
P15788 2.42e-06 48 35 0 64 1 PCC7418_2938 Ferredoxin Halothece sp. (strain PCC 7418)
P85121 2.44e-06 48 33 0 72 1 None Ferredoxin Panax ginseng
A6T526 2.53e-06 52 23 7 224 1 nqrF Na(+)-translocating NADH-quinone reductase subunit F Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q44257 2.54e-06 52 23 12 293 3 cbaB 3-chlorobenzoate-3,4-dioxygenase reductase subunit Comamonas testosteroni
O78510 2.6e-06 48 32 0 71 3 petF Ferredoxin Guillardia theta
P00255 2.7e-06 48 33 0 62 1 None Ferredoxin Thermostichus lividus
P81373 2.73e-06 48 33 1 75 1 None Ferredoxin-B Alocasia macrorrhizos
Q28CZ9 2.82e-06 52 27 7 154 2 cyb5r4 Cytochrome b5 reductase 4 Xenopus tropicalis
P00250 2.95e-06 48 36 0 69 1 None Ferredoxin-1 Aphanothece sacrum
P00229 2.99e-06 48 30 0 84 1 None Ferredoxin-1 Phytolacca americana
E2RTZ4 3.03e-06 52 23 9 248 1 hmpA Flavohemoprotein Giardia intestinalis (strain ATCC 50803 / WB clone C6)
O74557 3.06e-06 51 26 5 187 3 cbr1 NADH-cytochrome b5 reductase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P49522 3.12e-06 48 35 0 54 3 petF Ferredoxin Trieres chinensis
P0A3D1 3.17e-06 48 33 0 62 3 petF1 Ferredoxin-1 Thermostichus vulcanus
P0A3C9 3.17e-06 48 33 0 62 1 petF1 Ferredoxin-1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A3D0 3.17e-06 48 33 0 62 3 petF1 Ferredoxin-1 Synechococcus elongatus
P27789 3.26e-06 49 33 0 71 2 FDX5 Ferredoxin-5, chloroplastic Zea mays
P83584 3.31e-06 48 36 0 63 1 None Ferredoxin Solanum lasiocarpum
Q821Q3 3.33e-06 52 23 8 226 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P14937 3.59e-06 48 40 0 54 1 None Ferredoxin, root R-B2 Raphanus sativus
Q58841 4.47e-06 50 22 10 231 3 pyrK Probable dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P14936 4.82e-06 48 36 0 63 1 None Ferredoxin, root R-B1 Raphanus sativus
P81372 4.99e-06 47 30 0 72 1 None Ferredoxin-A Alocasia macrorrhizos
E1F8Q4 5.74e-06 51 22 8 249 3 hmpA-1 Flavohemoprotein-1 Giardia intestinalis (strain P15)
P16972 6.3e-06 48 35 0 64 1 FD2 Ferredoxin-2, chloroplastic Arabidopsis thaliana
A4TPL2 6.36e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis (strain Pestoides F)
Q1CLD8 6.36e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZBZ5 6.36e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis
Q1C4D5 6.36e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLJ3 6.36e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66E01 6.53e-06 51 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pseudotuberculosis serotype I (strain IP32953)
P00224 7.31e-06 47 34 0 64 1 None Ferredoxin-2 Spinacia oleracea
A3GF86 7.54e-06 50 22 5 193 3 CBR1 NADH-cytochrome b5 reductase 1 Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
P00241 7.77e-06 47 31 0 64 1 PETF Ferredoxin Cyanidium caldarium
P13106 8.08e-06 47 26 1 89 1 None Ferredoxin Bumilleriopsis filiformis
P00228 8.48e-06 48 30 0 71 1 PETF Ferredoxin, chloroplastic Triticum aestivum
P00245 8.85e-06 47 37 0 61 1 None Ferredoxin Limnospira maxima
A1JNZ2 9.09e-06 50 24 8 225 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P17007 9.29e-06 47 33 0 69 1 petF Ferredoxin-1 Cyanophora paradoxa
A8GAC4 9.59e-06 50 25 8 227 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Serratia proteamaculans (strain 568)
P00220 1.08e-05 47 29 0 74 1 None Ferredoxin Medicago sativa
A7TNL7 1.1e-05 50 23 6 184 3 CBR1 NADH-cytochrome b5 reductase 1 Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
P00243 1.1e-05 47 37 0 61 1 None Ferredoxin Synechocystis sp. (strain PCC 6714)
P27320 1.13e-05 47 37 0 61 1 petF Ferredoxin-1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P56408 1.26e-05 46 31 0 74 1 None Ferredoxin Scenedesmus fuscus
Q605A0 1.31e-05 50 33 2 77 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q605A0 0.000351 45 24 6 203 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9PLI3 1.48e-05 50 21 7 220 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia muridarum (strain MoPn / Nigg)
Q9URY5 1.55e-05 50 26 9 205 3 SPAC869.02c Flavohemoprotein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q45692 1.66e-05 49 34 0 70 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
Q45692 0.000208 46 20 3 191 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
P00247 1.84e-05 46 37 0 61 1 None Ferredoxin Chlorogloeopsis fritschii
Q255Y6 1.86e-05 49 22 7 223 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia felis (strain Fe/C-56)
O04090 2.28e-05 47 37 0 62 1 FD1 Ferredoxin-1, chloroplastic Arabidopsis thaliana
P00226 2.7e-05 45 29 0 74 1 None Ferredoxin Sambucus nigra
P84873 2.92e-05 45 31 0 73 1 None Ferredoxin-1 Hyoscyamus niger
P04669 3.33e-05 46 31 0 72 2 PETF Ferredoxin, chloroplastic Silene latifolia subsp. alba
B1AS42 3.47e-05 48 23 6 209 2 Cyb5rl NADH-cytochrome b5 reductase-like Mus musculus
P45154 3.79e-05 45 34 2 67 4 HI_1309 Uncharacterized ferredoxin-like protein HI_1309 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31965 3.84e-05 45 41 0 51 3 petF Ferredoxin-1 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P00246 3.9e-05 45 37 0 61 1 None Ferredoxin Arthrospira platensis
Q1XDG7 4.18e-05 45 30 0 65 3 petF Ferredoxin Neopyropia yezoensis
P00239 4.46e-05 45 32 0 71 1 None Ferredoxin-1 Dunaliella salina
Q8IED5 4.78e-05 47 27 0 80 1 FD Ferredoxin, apicoplast Plasmodium falciparum (isolate 3D7)
P00240 4.83e-05 45 28 0 87 1 None Ferredoxin-2 Dunaliella salina
P68165 4.9e-05 45 30 0 73 1 None Ferredoxin Datura stramonium
P68166 4.9e-05 45 30 0 73 1 None Ferredoxin Datura quercifolia
P00242 5.16e-05 45 33 0 54 1 PETF Ferredoxin Porphyra umbilicalis
P00221 5.26e-05 46 31 0 73 1 PETF Ferredoxin-1, chloroplastic Spinacia oleracea
P51320 5.33e-05 45 33 0 54 3 petF Ferredoxin Porphyra purpurea
P09911 6.33e-05 45 31 0 72 1 PETF Ferredoxin-1, chloroplastic Pisum sativum
Q0CY37 6.89e-05 47 23 5 184 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P00222 6.9e-05 44 31 0 64 1 None Ferredoxin Colocasia esculenta
Q59MV9 8.55e-05 47 21 6 195 2 YHB1 Flavohemoprotein Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6BUX2 9.25e-05 47 21 5 192 3 CBR1 NADH-cytochrome b5 reductase 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
P83524 9.43e-05 44 30 0 71 1 None Ferredoxin Alkekengi officinarum var. franchetii
A1C7E9 0.000109 47 25 7 188 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P07839 0.000112 44 29 0 86 1 PETF Ferredoxin, chloroplastic Chlamydomonas reinhardtii
P83523 0.00012 43 30 0 73 1 None Ferredoxin Lycium chinense
P00232 0.000121 43 28 0 84 1 None Ferredoxin-2 Phytolacca acinosa
P68164 0.000124 43 28 0 73 1 None Ferredoxin Datura metel
P68163 0.000124 43 28 0 73 1 None Ferredoxin Datura inoxia
P27967 0.000131 47 25 4 140 3 None Nitrate reductase [NADH] Hordeum vulgare
Q9UR35 0.000134 46 23 7 195 2 CBR1 NADH-cytochrome b5 reductase 1 Mortierella alpina
A1DHW1 0.000138 46 22 6 186 3 cbr1 NADH-cytochrome b5 reductase 1 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q9L6L9 0.000147 46 20 6 232 1 fre NAD(P)H-flavin reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P10770 0.00016 43 29 0 74 1 None Ferredoxin Peridinium bipes
P83585 0.000188 43 34 0 64 1 None Ferredoxin Solanum abutiloides
P46035 0.000193 43 32 1 64 3 fdxH Ferredoxin-2 Leptolyngbya boryana
P83526 0.000194 43 28 0 73 1 None Ferredoxin Nicotiana tabacum
P00238 0.000195 43 30 0 75 1 None Ferredoxin Scenedesmus quadricauda
P83582 0.000196 43 28 0 73 1 None Ferredoxin Solanum nigrum
P26475 0.000202 45 23 9 233 2 asrB Anaerobic sulfite reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O85675 0.000208 46 20 5 205 1 antC Anthranilate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P00223 0.000212 43 27 0 84 1 None Ferredoxin Arctium lappa
P83520 0.00022 43 28 0 73 1 None Ferredoxin Brugmansia arborea
Q9Z723 0.000226 46 26 3 94 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia pneumoniae
Q9ZQG8 0.000229 44 38 0 54 1 FD3 Ferredoxin-3, chloroplastic Arabidopsis thaliana
Q2UFN3 0.00024 45 22 4 186 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P07838 0.000253 43 31 0 61 1 None Ferredoxin Bryopsis maxima
Q9ZNT1 0.000254 45 25 5 152 1 CBR1 NADH--cytochrome b5 reductase 1 Arabidopsis thaliana
Q8GI14 0.000256 45 19 3 232 1 carAd Ferredoxin--NAD(P)(+) reductase CarAd Pseudomonas resinovorans
P83527 0.000263 43 30 0 73 1 None Ferredoxin Capsicum annuum var. annuum
Q9C7Y4 0.00027 44 29 0 78 2 FDC2 Ferredoxin C 2, chloroplastic Arabidopsis thaliana
Q4X0B5 0.000292 45 23 6 188 3 cbr1 NADH-cytochrome b5 reductase 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P00231 0.000296 42 28 0 84 1 None Ferredoxin-2 Phytolacca americana
O98450 0.000317 42 31 0 54 3 petF Ferredoxin Thalassiosira weissflogii
P00236 0.000329 42 39 1 51 1 None Ferredoxin-2 Equisetum telmateia
P84872 0.000348 42 28 0 73 1 None Ferredoxin Atropa belladonna
P84874 0.000377 42 28 0 73 1 None Ferredoxin-2 Hyoscyamus niger
P0AEN1 0.000379 45 20 6 232 1 fre NAD(P)H-flavin reductase Escherichia coli (strain K12)
P0AEN2 0.000379 45 20 6 232 3 fre NAD(P)H-flavin reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEN3 0.000379 45 20 6 232 3 fre NAD(P)H-flavin reductase Escherichia coli O157:H7
P83525 0.000384 42 29 0 71 1 None Ferredoxin Scopolia japonica
P00237 0.000704 41 38 1 49 1 None Ferredoxin-2 Equisetum arvense
Q43517 0.00076 42 30 0 73 2 SEND33 Ferredoxin-1, chloroplastic Solanum lycopersicum
P22341 0.000789 41 31 0 61 1 None Ferredoxin Euglena viridis
Q59P03 0.000878 44 22 6 183 3 CBR1 NADH-cytochrome b5 reductase 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
A5E7U2 0.001 43 19 4 190 3 CBR1 NADH-cytochrome b5 reductase 1 Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q5AZB4 0.001 43 22 4 186 3 cbr1 NADH-cytochrome b5 reductase 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A6VLY1 0.001 44 22 10 238 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10400
Feature type CDS
Gene hcr
Product NADH oxidoreductase
Location 2282582 - 2283586 (strand: -1)
Length 1005 (nucleotides) / 334 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_955
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain
PF00175 Oxidoreductase NAD-binding domain
PF00970 Oxidoreductase FAD-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1018 Energy production and conversion (C) C Flavodoxin/ferredoxin--NADP reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11933 NADH oxidoreductase Hcr [EC:1.-.-.-] - -

Protein Sequence

MTMPTALCPNRMQVHSIHQETPEVWTLNLINHDFYRYKPGQFALVSINNSDETMRAYTLSSSPGLSPFVSLTVRRIDNGVGSTWLTSQVKPGDYLWLSDAQGEFTCADREGTRYLMLAAGCGVTPIMSMTRWLLNNQPKADITVIFNIREQSQFIFEKEWLELANAYPYNLNFIMMPKLPDDKGIFSGRISQEKLAALVPDIANRTVMCCGPNSYMEDTARFAKNLGVCAENIFMERFGDEPMCVDEAQQLTMTIRHPLKQINVPVGMTLLTAMEENSVPVLAACRAGVCGSCKTRIVKGDYEVTSTSTLTADEIAQGYVLACSCRLTGDVELA

Flanking regions ( +/- flanking 50bp)

ATTCATCATCATTGCCGAAGCCTAAAGGCTTCGGTAAGGAAGCAATATCCATGACGATGCCAACAGCTCTTTGTCCTAATCGTATGCAAGTTCACTCTATCCATCAGGAAACCCCGGAAGTGTGGACACTGAATTTAATTAACCATGATTTTTATCGCTATAAACCCGGCCAATTTGCACTAGTCAGTATTAATAATAGCGATGAAACGATGCGAGCTTATACGCTCTCGTCTTCTCCGGGATTAAGTCCTTTTGTCTCTTTAACGGTTCGTCGTATCGACAATGGGGTGGGGTCAACGTGGTTAACATCCCAAGTTAAGCCGGGGGATTATCTCTGGTTATCAGACGCACAAGGGGAGTTCACCTGTGCAGATAGAGAAGGAACGCGCTATTTAATGCTCGCTGCGGGGTGCGGTGTGACCCCTATTATGTCGATGACGCGTTGGTTGTTAAATAATCAACCTAAAGCGGATATCACGGTCATTTTTAATATTCGCGAACAGAGCCAATTTATTTTTGAAAAAGAGTGGTTAGAGTTGGCTAATGCTTATCCCTATAATCTCAATTTTATTATGATGCCTAAGTTGCCGGATGATAAGGGAATTTTTAGTGGACGTATTTCTCAAGAAAAACTAGCCGCTTTAGTGCCTGATATTGCCAATCGTACAGTTATGTGTTGTGGGCCTAATAGTTATATGGAAGATACTGCGCGTTTTGCCAAAAATCTTGGTGTTTGTGCAGAGAATATTTTTATGGAACGTTTTGGTGATGAGCCAATGTGTGTTGATGAAGCACAACAACTTACTATGACTATTCGTCATCCGTTAAAGCAAATTAACGTACCGGTGGGGATGACATTATTAACAGCGATGGAAGAAAATAGTGTTCCTGTTTTGGCTGCTTGTCGTGCTGGAGTGTGTGGTAGCTGTAAAACACGCATTGTGAAAGGTGATTATGAGGTCACCAGCACCAGTACTTTAACTGCTGATGAGATAGCACAAGGTTATGTTTTAGCCTGTAGTTGTCGATTAACAGGTGATGTTGAACTAGCCTAATCATTCATTTTATTATCTATTCTTTATCTATCCTTCTATTTTACCCCGCT