Homologs in group_1582

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09905 FBDBKF_09905 100.0 Morganella morganii S1 fur ferric iron uptake transcriptional regulator
NLDBIP_04705 NLDBIP_04705 100.0 Morganella morganii S4 fur ferric iron uptake transcriptional regulator
LHKJJB_13925 LHKJJB_13925 100.0 Morganella morganii S3 fur ferric iron uptake transcriptional regulator
HKOGLL_12610 HKOGLL_12610 100.0 Morganella morganii S5 fur ferric iron uptake transcriptional regulator
F4V73_RS00445 F4V73_RS00445 96.6 Morganella psychrotolerans fur ferric iron uptake transcriptional regulator
PMI_RS02675 PMI_RS02675 91.2 Proteus mirabilis HI4320 fur ferric iron uptake transcriptional regulator

Distribution of the homologs in the orthogroup group_1582

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1582

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33086 8.53e-94 270 87 0 148 3 fur Ferric uptake regulation protein Yersinia pestis
P0A9A9 1.14e-92 268 86 0 148 1 fur Ferric uptake regulation protein Escherichia coli (strain K12)
P0A9B0 1.14e-92 268 86 0 148 3 fur Ferric uptake regulation protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9B1 1.14e-92 268 86 0 148 3 fur Ferric uptake regulation protein Escherichia coli O157:H7
Q83S79 1.04e-91 265 85 0 148 3 fur Ferric uptake regulation protein Shigella flexneri
P45599 7.82e-91 263 89 0 139 1 fur Ferric uptake regulation protein Klebsiella pneumoniae
P37736 4.09e-86 251 77 0 149 1 fur Ferric uptake regulation protein Vibrio anguillarum (strain ATCC 68554 / 775)
P0C6C8 7.91e-83 243 76 1 150 1 fur Ferric uptake regulation protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P33117 8.92e-83 243 77 0 148 3 fur Ferric uptake regulation protein Vibrio vulnificus (strain CMCP6)
O24755 1.35e-82 242 75 0 149 3 fur Ferric uptake regulation protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5F6G4 4.43e-82 241 76 1 150 3 fur Ferric uptake regulation protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q48835 1.18e-55 174 60 0 131 3 fur Ferric uptake regulation protein Legionella pneumophila
P44561 7.21e-55 172 62 0 132 3 fur Ferric uptake regulation protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71333 4.93e-54 170 59 1 135 3 fur Ferric uptake regulation protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
O30330 1.13e-51 164 58 0 131 3 fur Ferric uptake regulation protein Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q03456 3.98e-51 162 58 0 126 1 fur Ferric uptake regulation protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A3E3 8.52e-48 154 54 2 139 3 fur Ferric uptake regulation protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A3E5 8.52e-48 154 54 2 139 3 fur Ferric uptake regulation protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A3E4 8.52e-48 154 54 2 139 3 fur Ferric uptake regulation protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P0A0S8 7.13e-46 149 51 0 133 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0S7 7.13e-46 149 51 0 133 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0S9 9.9e-46 149 52 0 132 3 fur Ferric uptake regulation protein Neisseria meningitidis serogroup C
Q51008 9.9e-46 149 52 0 132 3 fur Ferric uptake regulation protein Neisseria gonorrhoeae
Q52083 1.58e-45 148 54 0 126 3 fur Ferric uptake regulation protein Pseudomonas putida
O68563 4.89e-44 144 56 0 120 3 fur Ferric uptake regulation protein (Fragment) Pseudomonas fluorescens
O07315 2.7e-31 112 42 2 135 1 fur Ferric uptake regulation protein Rhizobium leguminosarum bv. viciae
P0C631 1.26e-27 103 40 3 140 1 fur Ferric uptake regulation protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKI7 1.26e-27 103 40 3 140 3 fur Ferric uptake regulation protein Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q46463 3.15e-25 97 40 2 132 3 fur Ferric uptake regulation protein Campylobacter upsaliensis
P0C106 4.42e-25 96 37 1 129 3 fur Ferric uptake regulation protein Brucella abortus biovar 1 (strain 9-941)
Q2YRK0 4.42e-25 96 37 1 129 3 fur Ferric uptake regulation protein Brucella abortus (strain 2308)
Q8FZ45 6.25e-25 95 37 1 129 3 fur Ferric uptake regulation protein Brucella suis biovar 1 (strain 1330)
Q8YIR8 6.41e-24 93 36 1 129 3 fur Ferric uptake regulation protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P9WN85 1.69e-23 92 36 3 136 1 zur Zinc uptake regulation protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN84 1.69e-23 92 36 3 136 3 zur Zinc uptake regulation protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O25671 1.35e-17 77 29 1 129 1 fur Ferric uptake regulation protein Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM26 3.08e-17 76 29 1 129 3 fur Ferric uptake regulation protein Helicobacter pylori (strain J99 / ATCC 700824)
Q55244 9.23e-17 75 34 2 129 3 fur Ferric uptake regulation protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P54574 7.14e-16 72 34 1 132 1 fur Ferric uptake regulation protein Bacillus subtilis (strain 168)
P71086 4.41e-15 70 31 2 130 1 perR Peroxide operon regulator Bacillus subtilis (strain 168)
Q49YQ6 1.92e-14 69 29 2 135 3 perR Peroxide-responsive repressor PerR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A4T8 1.65e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain N315)
Q99T18 1.65e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A0J4 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MW2)
Q9RQL3 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus
Q6G873 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MSSA476)
Q6GFJ6 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain MRSA252)
Q5HER3 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain COL)
Q2YU25 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G282 2.22e-13 66 29 2 129 1 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFN4 2.22e-13 66 29 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus aureus (strain USA300)
Q8CNQ7 7.19e-13 65 28 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN74 7.19e-13 65 28 2 129 3 perR Peroxide-responsive repressor PerR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L7G4 8.18e-12 62 28 3 136 3 perR Peroxide-responsive repressor PerR Staphylococcus haemolyticus (strain JCSC1435)
Q97FU2 8.81e-11 59 27 2 135 1 perR Transcriptional regulator PerR Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P54479 2.5e-10 58 29 3 129 1 zur Zinc-specific metallo-regulatory protein Bacillus subtilis (strain 168)
P0C0P3 1.04e-09 56 33 4 134 3 fur Ferric uptake regulation protein Staphylococcus epidermidis
P0C0P4 3.38e-09 55 32 4 133 3 fur Ferric uptake regulation protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNZ4 3.38e-09 55 32 4 133 3 fur Ferric uptake regulation protein Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P74739 6.24e-09 55 34 3 138 3 fur Ferric uptake regulation protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WN87 1.19e-07 51 23 1 135 1 furA Transcriptional regulator FurA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN86 1.19e-07 51 23 1 135 3 furA Transcriptional regulator FurA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A583 1.19e-07 51 23 1 135 3 furA Transcriptional regulator FurA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0A034 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MW2)
P0C1Q1 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus
Q6G912 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MSSA476)
Q6GGE5 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain MRSA252)
P0A033 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain N315)
P0A032 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFK6 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain COL)
Q2FY19 1.3e-07 50 29 4 134 3 fur Ferric uptake regulation protein Staphylococcus aureus (strain NCTC 8325 / PS 47)
O69450 2.9e-07 50 28 1 100 3 fur1 Ferric uptake regulation protein 1 (Fragment) Mycolicibacterium fortuitum

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04705
Feature type CDS
Gene fur
Product ferric iron uptake transcriptional regulator
Location 268059 - 268508 (strand: 1)
Length 450 (nucleotides) / 149 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1582
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01475 Ferric uptake regulator family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0735 Inorganic ion transport and metabolism (P) P Fe2+ or Zn2+ uptake regulation protein Fur/Zur

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03711 Fur family transcriptional regulator, ferric uptake regulator - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG000478 ferric iron uptake transcriptional regulator VF0113 Regulation

Protein Sequence

MTDNNKALKNAGLKVTLPRLKILEVLQDPECHHVSAEDLYKKLIDIGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDESIESRQKNIAERHGIKLTNHSLYLYGHCADGDCRSDEGIHDEKK

Flanking regions ( +/- flanking 50bp)

GCGTTTTCCCGAATGTGCGCTCACCAGCGACAATATAGGACTAAATCCGCATGACCGATAACAATAAAGCATTGAAAAATGCAGGACTGAAAGTCACACTTCCCCGCCTGAAGATTCTGGAAGTGTTGCAGGATCCGGAGTGCCATCACGTCAGTGCGGAAGATCTCTACAAAAAACTGATCGATATCGGTGAAGAGATTGGACTCGCAACTGTCTACCGCGTTCTGAACCAGTTTGATGACGCCGGTATTGTCACCCGTCATAACTTTGAGGGCGGCAAATCCGTTTTCGAACTGACCCAGCAACACCACCACGATCACCTGATCTGCCTGGATTGCGGTAAAGTGATTGAGTTCAGTGATGAATCCATTGAATCACGTCAGAAAAATATCGCGGAACGCCACGGTATTAAACTCACCAACCACAGCCTGTACCTGTACGGCCACTGTGCGGATGGTGACTGCCGTTCTGATGAAGGTATCCACGACGAGAAAAAATAATTCTCGCCGTTAACCATTTTGTATGAAAGGCGCGTATCGCGCCTTTTTTG