Homologs in group_1531

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09570 FBDBKF_09570 100.0 Morganella morganii S1 moaE molybdopterin synthase catalytic subunit MoaE
NLDBIP_04370 NLDBIP_04370 100.0 Morganella morganii S4 moaE molybdopterin synthase catalytic subunit MoaE
LHKJJB_14260 LHKJJB_14260 100.0 Morganella morganii S3 moaE molybdopterin synthase catalytic subunit MoaE
HKOGLL_12275 HKOGLL_12275 100.0 Morganella morganii S5 moaE molybdopterin synthase catalytic subunit MoaE
F4V73_RS00775 F4V73_RS00775 96.7 Morganella psychrotolerans moaE molybdopterin synthase catalytic subunit MoaE
PMI_RS03020 PMI_RS03020 70.2 Proteus mirabilis HI4320 moaE molybdopterin synthase catalytic subunit MoaE

Distribution of the homologs in the orthogroup group_1531

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1531

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZGW2 1.66e-77 229 70 1 151 3 moaE Molybdopterin synthase catalytic subunit Yersinia pestis
P30749 2.8e-76 226 72 1 151 1 moaE Molybdopterin synthase catalytic subunit Escherichia coli (strain K12)
P65398 4.11e-76 226 71 1 151 3 moaE Molybdopterin synthase catalytic subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65399 4.11e-76 226 71 1 151 3 moaE Molybdopterin synthase catalytic subunit Salmonella typhi
Q9KT77 9.37e-64 194 61 1 149 3 moaE Molybdopterin synthase catalytic subunit Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7VLN4 9.04e-60 184 57 1 151 3 moaE Molybdopterin synthase catalytic subunit Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CN24 2.7e-59 183 56 1 151 3 moaE Molybdopterin synthase catalytic subunit Pasteurella multocida (strain Pm70)
P45308 8.07e-59 182 57 1 151 3 moaE Molybdopterin synthase catalytic subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8XZR3 7.65e-49 157 55 2 147 3 moaE Molybdopterin synthase catalytic subunit Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9HX97 7.16e-48 154 55 2 147 3 moaE Molybdopterin synthase catalytic subunit Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q984P0 6.74e-42 139 50 3 148 3 moaE Molybdopterin synthase catalytic subunit Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P65397 1.73e-37 128 43 3 148 3 moaE Molybdopterin synthase catalytic subunit Brucella suis biovar 1 (strain 1330)
P65396 1.73e-37 128 43 3 148 3 moaE Molybdopterin synthase catalytic subunit Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9AC50 1.18e-34 121 48 2 131 3 moaE Molybdopterin synthase catalytic subunit Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92QX5 1.29e-30 110 45 2 129 3 moaE Molybdopterin synthase catalytic subunit Rhizobium meliloti (strain 1021)
Q53091 1.48e-26 100 52 3 148 3 moaE Molybdopterin synthase catalytic subunit Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q97CL5 1.54e-24 95 38 0 111 3 moaE Molybdopterin synthase catalytic subunit Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
P9WJR3 1.48e-22 90 38 2 129 1 moaE1 Molybdopterin synthase catalytic subunit 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJR2 1.48e-22 90 38 2 129 3 moaE1 Molybdopterin synthase catalytic subunit 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q55371 1.36e-20 85 36 0 114 4 slr0903 Uncharacterized protein slr0903 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A4FUY7 1.37e-20 86 32 2 139 2 MOCS2 Molybdopterin synthase catalytic subunit Bos taurus
Q9K8I7 2.54e-20 84 40 1 110 3 moaE Molybdopterin synthase catalytic subunit Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9V2A7 3.01e-20 84 34 2 135 3 moaE Molybdopterin synthase catalytic subunit Pyrococcus abyssi (strain GE5 / Orsay)
Q9Z223 3.37e-20 85 32 2 139 1 Mocs2 Molybdopterin synthase catalytic subunit Mus musculus
A1CJM9 5.82e-20 84 39 0 116 3 cnxH Molybdopterin synthase catalytic subunit Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q6AY59 1.19e-19 84 32 2 139 2 Mocs2 Molybdopterin synthase catalytic subunit Rattus norvegicus
P65401 2.59e-19 81 35 1 134 1 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain N315)
P65400 2.59e-19 81 35 1 134 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NVA3 2.61e-19 81 35 1 134 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain MW2)
Q6G751 2.61e-19 81 35 1 134 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain MSSA476)
Q6GEG3 2.61e-19 81 35 1 134 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain MRSA252)
Q5HDT6 2.61e-19 81 35 1 134 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus aureus (strain COL)
O22827 3.7e-19 82 36 0 105 2 MOCS2 Molybdopterin synthase catalytic subunit Arabidopsis thaliana
Q9ZIM9 3.91e-19 81 40 1 110 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus carnosus (strain TM300)
Q8YWH5 6.01e-19 81 35 1 131 3 moaE Molybdopterin synthase catalytic subunit Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O96007 7.42e-19 81 33 0 107 1 MOCS2 Molybdopterin synthase catalytic subunit Homo sapiens
Q8CNE3 8.66e-19 80 38 1 121 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLX8 8.66e-19 80 38 1 121 3 moaE Molybdopterin synthase catalytic subunit Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A2X0R4 3.24e-18 80 37 1 114 3 MOCS2 Molybdopterin synthase catalytic subunit Oryza sativa subsp. indica
Q6Z2X3 3.97e-18 79 37 1 114 2 MOCS2 Molybdopterin synthase catalytic subunit Oryza sativa subsp. japonica
B4PUD1 2.87e-17 80 32 5 143 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila yakuba
Q9VBX2 3.31e-17 80 31 4 142 1 Mocs2B Molybdopterin synthase catalytic subunit Drosophila melanogaster
A1D7X4 4.07e-17 77 38 0 116 3 cnxH Molybdopterin synthase catalytic subunit Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
B4KBH3 4.8e-17 79 39 1 101 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila mojavensis
B4IJG7 5.84e-17 79 31 4 142 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila sechellia
B3P6R5 7.96e-17 79 32 5 143 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila erecta
Q4WWW9 8.11e-17 76 38 0 116 3 cnxH Molybdopterin synthase catalytic subunit Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XYQ4 8.11e-17 76 38 0 116 3 cnxH Molybdopterin synthase catalytic subunit Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
B4QUC0 8.54e-17 79 32 5 143 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila simulans
O31705 1.31e-16 75 36 1 110 3 moaE Molybdopterin synthase catalytic subunit Bacillus subtilis (strain 168)
Q171H3 1.88e-16 74 31 4 145 3 Mocs2-1 Molybdopterin synthase catalytic subunit 1 Aedes aegypti
Q1DGL6 1.96e-16 74 31 4 145 3 Mocs2-2 Molybdopterin synthase catalytic subunit 2 Aedes aegypti
B0X1V5 3.29e-16 73 31 3 146 3 Mocs2 Molybdopterin synthase catalytic subunit Culex quinquefasciatus
Q9Y8C1 5.04e-16 74 34 0 120 1 cnxH Molybdopterin synthase catalytic subunit Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B4LVP8 7.16e-16 76 35 5 128 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila virilis
B4JHP4 7.51e-16 76 36 1 101 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila grimshawi
B5FXU9 1.46e-15 72 30 3 139 2 MOCS2 Molybdopterin synthase catalytic subunit Taeniopygia guttata
Q56210 1.85e-15 72 34 2 117 3 moaE Molybdopterin synthase catalytic subunit Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B4GE20 2.17e-15 75 36 3 118 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila persimilis
B4NJW0 2.35e-15 74 37 4 123 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila willistoni
B3M268 2.64e-15 74 34 4 123 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila ananassae
Q297G3 4.17e-15 74 36 1 101 3 Mocs2B Molybdopterin synthase catalytic subunit Drosophila pseudoobscura pseudoobscura
A2QF55 1.17e-14 70 36 0 116 3 cnxH Molybdopterin synthase catalytic subunit Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q7QAD7 2.15e-14 69 32 2 117 3 Mocs2 Molybdopterin synthase catalytic subunit Anopheles gambiae
Q2U4W2 2.51e-14 69 34 0 116 3 cnxH Molybdopterin synthase catalytic subunit Aspergillus oryzae (strain ATCC 42149 / RIB 40)
O67928 4.87e-14 68 35 2 122 1 moaE Molybdopterin synthase catalytic subunit Aquifex aeolicus (strain VF5)
D4GSW7 2.43e-13 68 41 1 103 1 moaE Probable molybdopterin synthase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q86HF4 2.54e-13 66 27 4 145 3 mocs2l Molybdopterin synthase catalytic subunit Dictyostelium discoideum
Q5RA61 8.96e-13 65 29 1 107 2 MOCS2 Molybdopterin synthase catalytic subunit Pongo abelii
Q2KF83 3.85e-10 58 27 0 109 3 cnxH Molybdopterin synthase catalytic subunit Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q1DQS9 4.41e-10 58 30 1 121 3 cnxH Molybdopterin synthase catalytic subunit Coccidioides immitis (strain RS)
P9WJR1 7.18e-10 57 30 2 139 1 moaE2 Molybdopterin synthase catalytic subunit 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJR0 7.18e-10 57 30 2 139 3 moaE2 Molybdopterin synthase catalytic subunit 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2WBW4 3.66e-09 55 28 0 117 3 cnxH Molybdopterin synthase catalytic subunit Pyrenophora tritici-repentis (strain Pt-1C-BFP)
Q0V713 6.38e-08 52 28 1 122 3 cnxH Molybdopterin synthase catalytic subunit Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A7EVF4 1.26e-07 52 28 0 99 3 cnxH Molybdopterin synthase catalytic subunit Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q7SEW2 1.75e-07 51 27 0 99 3 nit-8 Molybdopterin synthase catalytic subunit Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A6R104 1.44e-06 49 29 0 100 3 cnxH Molybdopterin synthase catalytic subunit Ajellomyces capsulatus (strain NAm1 / WU24)
Q58127 2.24e-06 47 28 3 105 4 MJ0717 Uncharacterized protein MJ0717 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04370
Feature type CDS
Gene moaE
Product molybdopterin synthase catalytic subunit MoaE
Location 205021 - 205476 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1531
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02391 MoaE protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0314 Coenzyme transport and metabolism (H) H Molybdopterin synthase catalytic subunit MoaE

Kegg Ortholog Annotation(s)

Protein Sequence

MNNTRIAVQTDNFSVGEEYQWLAGCADDGAVVTFTGKVRNHNLGDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGGTRWVDARESDQKAADRW

Flanking regions ( +/- flanking 50bp)

CAGATGGTGACGAAGTTGCGTTCTTTCCGCCGGTCACCGGAGGCTGAGCCATGAATAATACCCGGATTGCTGTTCAGACGGACAATTTCAGTGTCGGTGAGGAATATCAGTGGCTGGCCGGTTGCGCGGATGACGGCGCGGTGGTCACCTTTACCGGTAAAGTCCGCAATCATAACCTGGGTGATAATGTGGCGGCTCTGTCGCTGGAGCACTACCCGGGCATGACCGAAAAAGCGCTGGCGGATATTGTCACACAGGCGCGTGAGCGCTGGGAATTACAGCGGGTGACGCTGATCCACAGGGTCGGCAGTTTATACCCGAATGATGAGATTGTGTTTGTCGGTGTCAGCGCCGCCCATCGCGGCATGGCATTTGAAGCGGCTGAATTTCTGATGGATTACTTAAAAACCCGCGCGCCGTTCTGGAAAAAAGAGACATTGCCGGAAGGCGGTACCCGCTGGGTGGATGCCAGAGAAAGCGACCAGAAAGCCGCAGATCGCTGGTAATTTACCGCTGATAACCTCCTGATCGCCGGATTTTTTCCGGCGGCTGTACA