Homologs in group_3634

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20570 FBDBKF_20570 100.0 Morganella morganii S1 - recombinase family protein
NLDBIP_04285 NLDBIP_04285 100.0 Morganella morganii S4 - recombinase family protein
LHKJJB_10115 LHKJJB_10115 100.0 Morganella morganii S3 - recombinase family protein
HKOGLL_08860 HKOGLL_08860 100.0 Morganella morganii S5 - recombinase family protein

Distribution of the homologs in the orthogroup group_3634

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3634

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77170 1.68e-21 90 32 5 164 3 pinQ Serine recombinase PinQ Escherichia coli (strain K12)
P0ADI0 5.42e-21 89 31 5 177 1 pinR Serine recombinase PinR Escherichia coli (strain K12)
P0ADI1 5.42e-21 89 31 5 177 3 pinR Putative DNA-invertase from lambdoid prophage Rac Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P05823 1.08e-17 80 30 6 177 3 tnpR Transposon Tn2501 resolvase Escherichia coli
P21424 6.19e-17 78 33 4 147 3 tnpR Transposon Tn1331 resolvase Klebsiella pneumoniae
P30739 7.87e-17 78 33 5 148 3 None Resolvase/recombinase Pseudomonas putida
P0ADI3 8.38e-17 78 33 4 147 3 tnpR Transposon Tn3 resolvase Klebsiella pneumoniae
P0ADI2 8.38e-17 78 33 4 147 1 tnpR Transposon Tn3 resolvase Escherichia coli
P03012 9.93e-16 75 31 4 147 1 tnpR Transposon gamma-delta resolvase Escherichia coli (strain K12)
P13606 2.44e-15 74 32 4 147 3 tnpR R46 site-specific recombinase Escherichia coli
P55389 8.13e-14 72 33 2 141 3 NGR_a00070 Probable DNA-invertase y4cG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P03014 1.62e-13 69 29 3 142 3 pinE Serine recombinase PinE Escherichia coli (strain K12)
P10311 2.03e-13 68 27 6 188 3 cin DNA-invertase Escherichia phage P1
P18358 5.27e-13 68 32 5 150 3 tnpR Transposon Tn552 resolvase Staphylococcus aureus
P06693 9.73e-13 67 31 4 144 3 tnpR Transposon Tn917 resolvase Enterococcus faecalis
P19241 1.02e-12 67 30 5 150 3 resR Transposon Tn552 DNA-invertase BinR Staphylococcus aureus
P21703 1.3e-12 67 26 5 188 3 cin DNA-invertase Enterobacteria phage P7
Q93MD2 3.63e-12 65 32 7 165 3 res Resolvase Clostridium perfringens (strain 13 / Type A)
P04130 9.3e-12 64 28 5 145 3 tnpR Transposon Tn21 resolvase Escherichia coli
Q02869 4.26e-11 62 25 4 183 3 hin DNA-invertase Salmonella abortus-equi
Q38199 4.56e-11 62 26 6 201 2 gin Serine recombinase gin Escherichia phage D108
P06691 4.89e-11 62 26 4 145 3 tnpR Transposon Tn501 resolvase Pseudomonas aeruginosa
P03015 4.99e-11 62 26 7 197 1 gin Serine recombinase gin Escherichia phage Mu
P07945 6.82e-11 62 31 7 165 3 res Resolvase Clostridium perfringens
P0C1G3 7.8e-11 62 26 5 145 3 tnpR Transposons Tn4653 resolvase Pseudomonas putida
P0C1G2 7.8e-11 62 26 5 145 3 tnpR Transposons Tn1721 resolvase Escherichia coli
P03013 3.29e-10 60 25 4 183 1 hin DNA-invertase hin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q06237 8.79e-09 56 31 5 145 3 None Transposon Tn1546 resolvase Enterococcus faecium
P18957 1.91e-07 52 30 3 118 3 uvp1 Protein uvp1 Escherichia coli
P20384 0.000156 44 25 6 148 1 bin3 Putative transposon Tn552 DNA-invertase bin3 Staphylococcus aureus

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04285
Feature type CDS
Gene -
Product recombinase family protein
Location 186268 - 186909 (strand: 1)
Length 642 (nucleotides) / 213 (amino acids)
In genomic island GI14

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3634
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00239 Resolvase, N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1961 Replication, recombination and repair (L) L Site-specific DNA recombinase SpoIVCA/DNA invertase PinE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K14060 putative DNA-invertase from lambdoid prophage Rac - -

Protein Sequence

MTVYAYTRVSKADNEYGTTDNQISIIESQLKIDHIYSDINISGSTAFNKRPEAQKMVSLLKSGDVIVIAKLDRGFRDTADCLNTIKWLKQKNVTLKILDIALDVSTPIGEMILTIMASVATFERKRIAERIKDGFNYGKSAGKKYGYNNEKIKAGILKRSIERKKATQIRYDIIKEHLKEKISNKSSERIMLDYLSSIDIRISRSTLRKILGR

Flanking regions ( +/- flanking 50bp)

TCAGAATGAATATTTCAAAAAATAAAAATAACAATTAATAGGATAATATAATGACAGTTTATGCTTACACCAGAGTATCTAAGGCAGATAATGAATATGGAACTACCGACAATCAGATTTCAATAATAGAGTCTCAGCTAAAAATAGATCATATTTATTCTGACATTAATATTTCAGGGTCTACAGCATTTAATAAAAGACCAGAAGCTCAAAAGATGGTTTCTCTATTAAAATCTGGCGATGTAATAGTGATAGCAAAGTTAGACAGAGGCTTCAGAGATACGGCTGATTGTTTGAATACTATCAAATGGTTAAAACAAAAGAATGTAACATTAAAGATACTAGACATTGCATTAGATGTATCTACACCTATTGGTGAAATGATACTCACTATAATGGCTTCGGTTGCAACTTTTGAAAGAAAACGAATAGCAGAACGCATCAAAGATGGTTTTAACTATGGCAAATCAGCAGGTAAAAAATACGGTTATAACAATGAAAAAATAAAAGCTGGTATATTAAAAAGGTCAATAGAAAGAAAAAAAGCCACGCAGATTCGATATGATATAATAAAAGAACATCTTAAAGAAAAAATATCAAATAAATCATCTGAACGTATCATGCTTGACTATTTATCTTCTATTGACATTAGAATATCCAGAAGCACATTACGAAAGATATTAGGACGTTAATTATATTTAACAAAATTATTAATATCTAGCTTCTTTGATTAAACTATCGC