Homologs in group_1206

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07005 FBDBKF_07005 100.0 Morganella morganii S1 artM arginine ABC transporter permease ArtM
NLDBIP_03965 NLDBIP_03965 100.0 Morganella morganii S4 artM arginine ABC transporter permease ArtM
LHKJJB_09795 LHKJJB_09795 100.0 Morganella morganii S3 artM arginine ABC transporter permease ArtM
HKOGLL_09180 HKOGLL_09180 100.0 Morganella morganii S5 artM arginine ABC transporter permease ArtM
F4V73_RS01195 F4V73_RS01195 82.9 Morganella psychrotolerans artM arginine ABC transporter permease ArtM
PMI_RS03340 PMI_RS03340 75.7 Proteus mirabilis HI4320 artM arginine ABC transporter permease ArtM

Distribution of the homologs in the orthogroup group_1206

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1206

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE33 2.77e-107 310 67 0 222 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 2.77e-107 310 67 0 222 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 2.77e-107 310 67 0 222 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 2.77e-107 310 67 0 222 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P45089 2.99e-65 204 52 2 219 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P35113 4.18e-47 158 43 2 192 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
P72296 5.78e-39 137 38 3 214 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
P35114 7.63e-37 132 36 4 219 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P42200 7.42e-24 98 31 4 208 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
P0A2I7 1.18e-23 97 31 2 208 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 1.18e-23 97 31 2 208 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
P0AFT4 1.44e-22 94 36 4 161 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 1.44e-22 94 36 4 161 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 1.44e-22 94 36 4 161 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU6 1.82e-22 94 35 2 165 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 1.82e-22 94 35 2 165 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 1.82e-22 94 35 2 165 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 1.82e-22 94 35 2 165 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P0AE36 1.92e-22 94 29 5 232 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 1.92e-22 94 29 5 232 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 1.92e-22 94 29 5 232 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34315 8.22e-22 92 30 3 216 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P42399 1.37e-21 92 28 4 209 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
P54536 1.79e-21 91 30 4 209 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
P45023 5.01e-20 87 30 5 195 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52625 1.95e-19 86 33 5 210 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
P54953 4.34e-19 85 28 5 218 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
P0AEQ9 2.99e-18 83 32 4 167 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 2.99e-18 83 32 4 167 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 2.99e-18 83 32 4 167 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 2.99e-18 83 32 4 167 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
Q1RHC0 1.47e-17 81 27 4 214 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
P41083 5.86e-17 79 26 4 213 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
P0AER3 7.44e-17 79 28 6 220 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 7.44e-17 79 28 6 220 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q4UKC4 8.08e-17 79 27 4 213 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P45090 1.03e-16 79 28 4 178 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q68XN8 4.76e-16 77 26 4 213 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O34931 1.36e-15 76 25 4 213 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
Q92J96 1.54e-15 75 26 4 213 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P55660 2.38e-15 75 29 7 226 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A2I9 3.68e-15 75 27 3 210 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 3.68e-15 75 27 3 210 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
Q8NQU3 2.9e-14 73 27 6 212 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P52094 1.74e-13 70 26 3 210 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
O34606 3.21e-12 66 27 5 209 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P72295 1.01e-10 62 30 5 193 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
Q52814 2.37e-10 62 28 3 166 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0AER5 5.73e-10 60 27 8 217 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 5.73e-10 60 27 8 217 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 5.73e-10 60 27 8 217 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
P0A4N5 1.51e-09 59 28 5 186 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 1.51e-09 59 28 5 186 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P55661 6.24e-09 57 21 5 215 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P35118 5.83e-08 55 28 3 128 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q52665 5.46e-07 53 24 7 224 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34671 5.32e-06 49 24 8 222 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
P48245 8.97e-06 48 28 6 221 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P45768 1.39e-05 48 32 1 81 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P45767 0.000347 44 25 7 175 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
Q8RQL4 0.000403 43 25 6 220 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q52813 0.000413 44 23 3 125 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03965
Feature type CDS
Gene artM
Product arginine ABC transporter permease ArtM
Location 120349 - 121023 (strand: 1)
Length 675 (nucleotides) / 224 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1206
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4160 Amino acid transport and metabolism (E) E ABC-type arginine/histidine transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09998 arginine transport system permease protein ABC transporters -

Protein Sequence

MSIFDYILAVLPGLPVSLSLTFTALITAFLLSVLFTLVLSLKPRVLTPLVKGYITLFTGTPLLVQFFLIYFGPAQFEGLKNYPLLWELMSSPWLCAMVTLALNSAAYSTLLFYGAVKAIPKGQWQSCQALGMSQKQTMRIILPYAFKRALSSYSNEVVLIFKSTSLATTISLLEVMGYSRRLFGQDYDLNVFIAAGIIYLAVNSLLTLAMRLIERRALAFEHRN

Flanking regions ( +/- flanking 50bp)

ATCCTCAAACGTATCGAACTGCGTACCACACGTTTTGAACGGAGCGGCCAATGAGCATATTTGATTATATTCTTGCCGTCTTACCGGGCCTGCCGGTCAGTCTGTCACTGACCTTTACCGCACTGATCACGGCGTTTCTGCTGTCAGTGCTGTTTACACTGGTACTCTCTCTCAAACCCCGGGTTCTGACGCCGCTGGTCAAAGGGTATATCACCCTGTTTACCGGGACGCCGCTGCTGGTCCAGTTTTTCCTGATTTATTTCGGGCCCGCGCAGTTTGAAGGGCTGAAAAACTATCCGCTGCTGTGGGAACTGATGTCCTCCCCGTGGCTCTGTGCCATGGTGACACTGGCGCTCAACAGTGCGGCTTATTCGACACTGCTGTTCTACGGTGCGGTAAAAGCAATTCCGAAAGGTCAGTGGCAGTCCTGTCAGGCGCTGGGAATGTCGCAGAAGCAGACCATGCGGATTATCCTGCCCTATGCCTTTAAACGTGCATTGTCGTCCTATTCCAACGAAGTGGTGCTGATTTTCAAAAGTACCTCACTGGCCACGACGATTTCACTGCTTGAAGTTATGGGCTACAGCCGCCGCCTGTTTGGTCAGGATTACGATCTGAACGTCTTTATTGCTGCGGGGATTATTTACCTGGCCGTCAACAGCCTGCTGACGCTGGCGATGCGTCTGATTGAACGCCGCGCGCTGGCATTCGAACACCGTAACTGATCCGCTCATACAGAAACGGGGCTGACGTATACACGCAGCCCCGTTTTTTT