Homologs in group_1270

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07045 FBDBKF_07045 100.0 Morganella morganii S1 macA macrolide transporter subunit MacA
NLDBIP_03925 NLDBIP_03925 100.0 Morganella morganii S4 macA macrolide transporter subunit MacA
LHKJJB_09755 LHKJJB_09755 100.0 Morganella morganii S3 macA macrolide transporter subunit MacA
HKOGLL_09220 HKOGLL_09220 100.0 Morganella morganii S5 macA macrolide transporter subunit MacA
F4V73_RS01230 F4V73_RS01230 90.6 Morganella psychrotolerans macA macrolide transporter subunit MacA
PMI_RS03375 PMI_RS03375 63.9 Proteus mirabilis HI4320 macA macrolide transporter subunit MacA

Distribution of the homologs in the orthogroup group_1270

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1270

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64177 3.87e-123 360 58 0 313 3 macA Macrolide export protein MacA Shigella flexneri
P64176 3.87e-123 360 58 0 313 3 macA Macrolide export protein MacA Escherichia coli O157:H7
P75830 2.55e-122 358 58 0 313 1 macA Macrolide export protein MacA Escherichia coli (strain K12)
P58411 3.29e-117 345 56 0 311 3 macA Macrolide export protein MacA Yersinia pestis
Q9I191 9.33e-52 178 34 1 338 1 pvdR Pyoverdine export membrane fusion protein PvdR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88F89 3.87e-47 166 32 2 340 1 pvdR Pyoverdine export membrane fusion protein PvdR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9L9D4 3.03e-19 90 29 8 299 3 None UPF0194 membrane protein in asrC 5'region (Fragment) Acidithiobacillus ferridurans
D3V7P2 6.05e-18 87 30 9 328 3 mdtA Multidrug resistance protein MdtA Xenorhabdus bovienii (strain SS-2004)
Q7N3E3 6.22e-17 84 29 10 336 3 mdtA Multidrug resistance protein MdtA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W8D7 6.84e-15 77 25 6 293 3 Ent638_1286 UPF0194 membrane protein Ent638_1286 Enterobacter sp. (strain 638)
C9XVZ5 3.38e-14 76 27 11 325 3 mdtA Multidrug resistance protein MdtA Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
A8AIZ1 5.48e-14 75 26 6 293 3 CKO_02332 UPF0194 membrane protein CKO_02332 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XSP8 1.68e-13 73 29 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Klebsiella pneumoniae (strain 342)
A7FDT5 1.69e-13 73 28 4 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5R785 2.8e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella gallinarum (strain 287/91 / NCTC 13346)
B7LRL6 2.89e-13 72 29 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A9MIT3 3.26e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZQP0 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z879 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella typhi
C0PX06 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi C (strain RKS4594)
B5QXS4 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella enteritidis PT4 (strain P125109)
B5FP83 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella dublin (strain CT_02021853)
Q57RE0 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella choleraesuis (strain SC-B67)
B5F095 3.41e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella agona (strain SL483)
B4TQW1 4.12e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella schwarzengrund (strain CVM19633)
A9MSW1 4.12e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T074 4.12e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella newport (strain SL254)
B4TC72 4.12e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella heidelberg (strain SL476)
B5BC09 4.24e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain AKU_12601)
Q5PG34 4.24e-13 72 25 8 293 3 ybhG UPF0194 membrane protein YbhG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1JKI2 5.67e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665H1 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THE9 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pestis (strain Pestoides F)
Q1CDW6 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1V9 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAU9 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pestis
B2K437 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1L2 6.11e-13 71 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia pestis bv. Antiqua (strain Antiqua)
B7M457 9.63e-13 72 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O8 (strain IAI1)
Q8CVX8 1.01e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MWY7 1.07e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O81 (strain ED1a)
B2TYA9 1.08e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YUD2 1.08e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7J5 1.08e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O157:H7
Q0TG16 1.1e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZNP7 1.18e-12 71 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BHN6 1.31e-12 71 27 11 336 3 mdtA Multidrug resistance protein MdtA Edwardsiella ictaluri (strain 93-146)
B7NLF9 2.06e-12 70 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83P86 2.07e-12 70 28 4 242 3 mdtN Multidrug resistance protein MdtN Shigella flexneri
Q57500 2.2e-12 70 27 5 262 3 HI_0894 Uncharacterized protein HI_0894 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P76397 2.29e-12 70 27 10 325 2 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12)
A8A1U6 2.29e-12 70 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O9:H4 (strain HS)
B1X7H0 2.29e-12 70 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / DH10B)
C4ZSG2 2.29e-12 70 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain K12 / MC4100 / BW2952)
B7UTB2 2.29e-12 70 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7ME86 2.34e-12 70 26 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O45:K1 (strain S88 / ExPEC)
P0AFV0 2.42e-12 70 26 5 241 1 yibH Inner membrane protein YibH Escherichia coli (strain K12)
P0AFV1 2.42e-12 70 26 5 241 3 yibH Inner membrane protein YibH Escherichia coli O157:H7
B7LV38 2.84e-12 70 27 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8A550 3.03e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O9:H4 (strain HS)
Q0T047 3.77e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Shigella flexneri serotype 5b (strain 8401)
P46482 3.77e-12 69 28 5 201 2 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain K12)
B1XHL3 3.77e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain K12 / DH10B)
C4ZSX9 3.77e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain K12 / MC4100 / BW2952)
B7LHU9 3.77e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain 55989 / EAEC)
A7ZSD5 3.77e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O139:H28 (strain E24377A / ETEC)
B7M0V3 3.88e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O8 (strain IAI1)
Q83Q03 3.92e-12 69 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Shigella flexneri
B7NQB2 4.93e-12 69 26 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NDL9 5.25e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q32B98 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Shigella dysenteriae serotype 1 (strain Sd197)
Q1R698 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain UTI89 / UPEC)
B1LGK7 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain SMS-3-5 / SECEC)
B6I1V9 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain SE11)
B1IQN8 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FD50 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCM4 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGD4 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O1:K1 / APEC
B7N0M6 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O81 (strain ED1a)
B7MC02 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJX3 5.45e-12 68 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83KI5 5.53e-12 69 26 10 325 3 mdtA Putative multidrug resistance protein MdtA Shigella flexneri
D2BTK6 6.25e-12 69 26 11 325 3 mdtA Multidrug resistance protein MdtA Dickeya zeae (strain Ech586)
B4TX73 6.77e-12 68 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella schwarzengrund (strain CVM19633)
B5F7M5 6.77e-12 68 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella agona (strain SL483)
P32716 7.44e-12 68 28 4 242 2 mdtN Multidrug resistance protein MdtN Escherichia coli (strain K12)
P44928 8.22e-12 68 27 6 236 3 emrA Multidrug export protein EmrA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B7L9U7 8.41e-12 68 26 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain 55989 / EAEC)
P76185 8.62e-12 68 29 6 209 3 ydhJ Uncharacterized protein YdhJ Escherichia coli (strain K12)
B7NCB0 9.83e-12 68 26 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1JRH9 1.36e-11 67 27 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3YX06 1.46e-11 67 28 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Shigella sonnei (strain Ss046)
A6TBH3 1.56e-11 68 29 15 341 3 mdtA Multidrug resistance protein MdtA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P37636 1.66e-11 68 28 8 260 1 mdtE Multidrug resistance protein MdtE Escherichia coli (strain K12)
Q7CPM8 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF83 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella typhi
B5BGR9 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella paratyphi A (strain AKU_12601)
C0PZR0 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella paratyphi C (strain RKS4594)
A9N863 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJT8 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T775 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella newport (strain SL254)
B4TJT9 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella heidelberg (strain SL476)
B5R1A8 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella enteritidis PT4 (strain P125109)
B5FIU3 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella dublin (strain CT_02021853)
Q57JA3 1.69e-11 67 29 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella choleraesuis (strain SC-B67)
Q8X5R2 1.75e-11 67 27 4 242 3 mdtN Multidrug resistance protein MdtN Escherichia coli O157:H7
Q8X4L0 1.87e-11 67 28 8 260 3 mdtE Multidrug resistance protein MdtE Escherichia coli O157:H7
B1LNW7 2.15e-11 67 26 10 325 3 mdtA Multidrug resistance protein MdtA Escherichia coli (strain SMS-3-5 / SECEC)
P37683 2.68e-11 67 27 5 241 1 yiaV Inner membrane protein YiaV Escherichia coli (strain K12)
Q8CVL1 3.19e-11 67 31 5 176 3 mdtE Multidrug resistance protein MdtE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FAX1 4.69e-11 66 27 4 242 3 mdtN Multidrug resistance protein MdtN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A9MNW9 5.86e-11 65 28 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A1JSL8 8.85e-11 65 23 7 249 3 YE2891 UPF0194 membrane protein YE2891 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
F2EYD8 1.3e-10 65 26 11 325 3 mdtA Multidrug resistance protein MdtA Pantoea ananatis (strain AJ13355)
B5REW3 1.69e-10 64 28 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Salmonella gallinarum (strain 287/91 / NCTC 13346)
D4I6V2 1.99e-10 64 26 10 325 3 mdtA Multidrug resistance protein MdtA Erwinia amylovora (strain ATCC 49946 / CCPPB 0273 / Ea273 / 27-3)
B5YSW7 2.13e-10 64 28 6 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9E5 2.13e-10 64 28 6 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Escherichia coli O157:H7
B4EY99 2.86e-10 64 32 2 143 3 mdtA Multidrug resistance protein MdtA Proteus mirabilis (strain HI4320)
A7MJB1 3.27e-10 63 28 4 193 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Cronobacter sakazakii (strain ATCC BAA-894)
A4WF55 3.33e-10 63 28 7 207 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Enterobacter sp. (strain 638)
Q6DAH5 3.59e-10 63 26 4 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIM2 4.48e-10 63 26 4 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JKX1 5.89e-10 63 34 3 141 3 mdtA Multidrug resistance protein MdtA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P43505 6.57e-10 63 26 10 324 3 mtrC Membrane fusion protein MtrC Neisseria gonorrhoeae
B1JSD5 6.77e-10 63 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A8AQD5 7.61e-10 62 27 5 201 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q92V44 8.27e-10 62 25 7 292 3 RB0873 UPF0194 membrane protein RB0873 Rhizobium meliloti (strain 1021)
A4WCC0 9.01e-10 62 34 3 141 3 mdtA Multidrug resistance protein MdtA Enterobacter sp. (strain 638)
A4TMR2 1e-09 62 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pestis (strain Pestoides F)
Q1CK59 1e-09 62 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCW1 1e-09 62 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pestis
Q1C5M1 1e-09 62 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FG18 1.04e-09 62 27 11 329 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P25196 1.28e-09 62 24 6 261 3 nolF Nodulation protein NolF Rhizobium meliloti (strain 1021)
P52599 2.35e-09 61 25 13 334 2 emrK Probable multidrug resistance protein EmrK Escherichia coli (strain K12)
Q668C7 3e-09 61 32 3 141 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K9L9 3e-09 61 32 3 141 3 mdtA Multidrug resistance protein MdtA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C6DBC6 4.25e-09 60 32 3 139 3 mdtA Multidrug resistance protein MdtA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8Z5F8 4.37e-09 60 25 9 325 3 mdtA Multidrug resistance protein MdtA Salmonella typhi
C0Q1F4 4.37e-09 60 25 9 325 3 mdtA Multidrug resistance protein MdtA Salmonella paratyphi C (strain RKS4594)
Q8ZNQ3 6.05e-09 60 25 9 325 3 mdtA Multidrug resistance protein MdtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T9U0 7.8e-09 60 25 9 325 3 mdtA Multidrug resistance protein MdtA Salmonella heidelberg (strain SL476)
A7ZJK6 9.41e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0T6G6 9.95e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri serotype 5b (strain 8401)
B1LM86 9.95e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SMS-3-5 / SECEC)
B1IXH3 9.95e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZY51 9.95e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O9:H4 (strain HS)
B5YS86 9.95e-09 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7 (strain EC4115 / EHEC)
B6I7V1 1.05e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain SE11)
P75777 1.05e-08 59 24 9 293 2 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12)
B1X7C5 1.05e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / DH10B)
C4ZXW7 1.05e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain K12 / MC4100 / BW2952)
B7M768 1.05e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O8 (strain IAI1)
B7LC78 1.05e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain 55989 / EAEC)
B7LJW4 1.07e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NA95 1.07e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NNM5 1.07e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8X7Y9 1.07e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O157:H7
B7ULZ2 1.07e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32I67 1.16e-08 59 24 9 293 3 ybhG UPF0194 membrane protein YbhG Shigella dysenteriae serotype 1 (strain Sd197)
B2K8W1 1.29e-08 58 23 6 249 3 YPTS_1292 UPF0194 membrane protein YPTS_1292 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66D37 1.29e-08 58 23 6 249 3 YPTB1212 UPF0194 membrane protein YPTB1212 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8FWV8 2.74e-08 58 27 12 323 1 bepF Efflux pump periplasmic linker BepF Brucella suis biovar 1 (strain 1330)
Q6D2B2 3.08e-08 58 32 3 139 3 mdtA Multidrug resistance protein MdtA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z3Z0 3.19e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Shigella sonnei (strain Ss046)
Q0TJQ3 3.27e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FJN6 3.4e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A936 4.28e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O1:K1 / APEC
B7MQP9 4.28e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O81 (strain ED1a)
B7MGQ3 4.28e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli O45:K1 (strain S88 / ExPEC)
Q83S36 4.77e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Shigella flexneri
Q1RED2 4.95e-08 57 24 9 293 3 ybhG UPF0194 membrane protein YbhG Escherichia coli (strain UTI89 / UPEC)
Q93AA7 7.35e-08 56 23 6 249 3 YP_0975 UPF0194 membrane protein YP_0975 Yersinia pestis
B1JSP3 7.35e-08 56 23 6 249 3 YPK_2900 UPF0194 membrane protein YPK_2900 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CFT7 7.35e-08 56 23 6 249 3 YPN_2816 UPF0194 membrane protein YPN_2816 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FKJ7 7.35e-08 56 23 6 249 3 YpsIP31758_2812 UPF0194 membrane protein YpsIP31758_2812 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1C912 7.35e-08 56 23 6 249 3 YPA_1093 UPF0194 membrane protein YPA_1093 Yersinia pestis bv. Antiqua (strain Antiqua)
P37626 1.58e-07 55 25 6 269 3 yhiI Uncharacterized protein YhiI Escherichia coli (strain K12)
Q323Z9 1.59e-07 55 23 9 293 3 ybhG UPF0194 membrane protein YbhG Shigella boydii serotype 4 (strain Sb227)
B2VGW1 3.36e-07 54 26 5 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GK45 3.8e-07 54 25 4 189 3 aaeA p-hydroxybenzoic acid efflux pump subunit AaeA Serratia proteamaculans (strain 568)
P27303 4.89e-07 54 25 6 220 1 emrA Multidrug export protein EmrA Escherichia coli (strain K12)
Q93PU5 7.49e-07 53 28 4 173 2 ttgG Toluene efflux pump periplasmic linker protein TtgG Pseudomonas putida (strain DOT-T1E)
O31099 7.82e-07 53 28 4 173 2 srpA Solvent efflux pump periplasmic linker SrpA Pseudomonas putida
Q9KWV5 1.81e-06 52 24 11 326 2 ttgD Toluene efflux pump periplasmic linker protein TtgD Pseudomonas putida (strain DOT-T1E)
Q849Q9 1.81e-06 52 24 11 326 3 sepA Probable efflux pump periplasmic linker protein SepA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P13510 4.26e-06 51 26 3 177 1 czcB Cobalt-zinc-cadmium resistance protein CzcB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0AE06 8.2e-06 50 31 4 185 1 acrA Multidrug efflux pump subunit AcrA Escherichia coli (strain K12)
P0AE07 8.2e-06 50 31 4 185 3 acrA Multidrug efflux pump subunit AcrA Escherichia coli O157:H7
P24180 1.07e-05 50 28 3 185 1 acrE Multidrug export protein AcrE Escherichia coli (strain K12)
Q9KJC3 1.57e-05 49 27 4 185 2 arpA Antibiotic efflux pump periplasmic linker protein ArpA Pseudomonas putida
Q9WWZ9 1.98e-05 49 25 3 185 2 ttgA Toluene efflux pump periplasmic linker protein TtgA Pseudomonas putida (strain DOT-T1E)
Q88N30 2.03e-05 49 25 3 185 1 ttgA Probable efflux pump periplasmic linker TtgA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0C069 2.03e-05 49 25 3 185 1 mepA Multidrug/solvent efflux pump periplasmic linker protein MepA Pseudomonas putida
P37973 5.08e-05 48 26 5 176 2 cnrB Nickel and cobalt resistance protein CnrB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9RQ30 0.000125 47 27 6 217 1 farA Fatty acid resistance protein FarA Neisseria gonorrhoeae
P94176 0.000233 46 25 3 177 3 czcB Cation efflux system protein CzcB Alcaligenes sp. (strain CT14)
Q44585 0.00037 45 25 7 207 3 nccB Nickel-cobalt-cadmium resistance protein NccB Alcaligenes xylosoxydans xylosoxydans
P52477 0.000898 44 26 3 173 1 mexA Multidrug resistance protein MexA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03925
Feature type CDS
Gene macA
Product macrolide transporter subunit MacA
Location 112607 - 113569 (strand: -1)
Length 963 (nucleotides) / 320 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1270
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF16576 Barrel-sandwich domain of CusB or HlyD membrane-fusion

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0845 Cell wall/membrane/envelope biogenesis (M)
Defense mechanisms (V)
MV Multidrug efflux pump subunit AcrA (membrane-fusion protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13888 membrane fusion protein, macrolide-specific efflux system - -

Protein Sequence

MATGKLDALQKVDVGAQVNGQLQTLNVKEGDFVKKGDLLAVIDPVKAQNVVIEAEQTVSEIKARLKQAEAEYAFAQATYQRRLALAKTQVISKQDVDEARRNMDVQRAAIDTYKAQVARNQATLDTARNDLQYTNIRAPMDGVVTELKTLQGQTVIAMQQAPTILSLADLDTMLVNAEVSEADVVYLKPGQKATFSVLGAPDKSFSGVITDILPKPQKINDAIFYYARFEVPNPQHVLKLDMTAQVTIALENRENVLKIPLAALGKEISPTEYEVQVLVNGQPETRQVTLGTRNDVEAEVTKGLAEHEKVVTGIDDGTAG

Flanking regions ( +/- flanking 50bp)

TCAGCTATATGACAGCGGATGTGCAGCGCGGCACACTCTAAAAAAAAGTGATGGCCACCGGCAAGCTGGATGCACTGCAGAAAGTGGATGTCGGTGCGCAGGTCAACGGGCAGCTGCAGACCCTGAATGTCAAAGAGGGTGATTTTGTTAAGAAGGGCGATTTGCTGGCGGTCATCGACCCGGTCAAAGCGCAGAACGTGGTGATTGAGGCCGAGCAGACGGTCAGTGAAATCAAAGCACGGCTGAAGCAGGCAGAGGCGGAGTATGCTTTTGCACAGGCGACCTATCAGCGGCGGCTGGCACTGGCAAAAACTCAGGTTATCTCAAAGCAGGATGTGGACGAGGCGCGGCGCAATATGGATGTGCAGCGCGCGGCGATTGACACCTATAAAGCCCAGGTGGCACGCAATCAGGCCACACTCGATACCGCCCGCAATGATTTGCAGTACACCAATATCCGCGCGCCGATGGACGGCGTGGTGACGGAGCTGAAAACCTTACAGGGGCAGACGGTGATTGCCATGCAGCAGGCGCCGACCATCCTCTCCCTGGCGGATCTCGATACCATGCTGGTGAATGCGGAAGTTTCCGAGGCAGATGTGGTGTATCTGAAACCCGGCCAGAAAGCCACGTTCAGTGTGCTGGGCGCGCCGGACAAATCCTTCAGCGGCGTGATCACCGATATCCTGCCGAAACCGCAGAAAATCAATGACGCCATTTTCTATTATGCCCGTTTTGAAGTGCCGAACCCGCAGCATGTGCTGAAACTGGACATGACTGCCCAGGTCACTATCGCGCTGGAAAACCGCGAAAACGTGCTGAAAATCCCGCTGGCGGCACTCGGTAAAGAGATCTCCCCGACCGAATACGAAGTGCAGGTGCTGGTGAATGGTCAGCCGGAAACCCGTCAGGTGACACTCGGCACCCGTAATGATGTGGAAGCTGAGGTGACAAAAGGTCTGGCAGAGCATGAAAAAGTGGTGACCGGTATTGATGACGGCACAGCAGGATAATTCATGAGCGCATTATTAGAACTGCGGAATATTTACCGCCGTTATCCTTC