Homologs in group_1272

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07060 FBDBKF_07060 100.0 Morganella morganii S1 clpS ATP-dependent Clp protease adapter ClpS
NLDBIP_03910 NLDBIP_03910 100.0 Morganella morganii S4 clpS ATP-dependent Clp protease adapter ClpS
LHKJJB_09740 LHKJJB_09740 100.0 Morganella morganii S3 clpS ATP-dependent Clp protease adapter ClpS
HKOGLL_09235 HKOGLL_09235 100.0 Morganella morganii S5 clpS ATP-dependent Clp protease adapter ClpS
F4V73_RS01245 F4V73_RS01245 93.4 Morganella psychrotolerans clpS ATP-dependent Clp protease adapter ClpS
PMI_RS03390 PMI_RS03390 61.5 Proteus mirabilis HI4320 clpS ATP-dependent Clp protease adapter ClpS

Distribution of the homologs in the orthogroup group_1272

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1272

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N6F7 3.27e-49 154 62 0 106 3 clpS ATP-dependent Clp protease adapter protein ClpS Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JRG2 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CL0 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TN41 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pestis (strain Pestoides F)
Q1CGD9 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4Y5 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGD5 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pestis
B2KA00 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA97 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJZ4 5.79e-49 154 68 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DF43 5.79e-49 154 63 0 106 3 clpS ATP-dependent Clp protease adapter protein ClpS Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JMC5 2.31e-48 152 67 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D3T7 7.21e-48 151 61 0 106 3 clpS ATP-dependent Clp protease adapter protein ClpS Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GCD7 9.28e-48 150 70 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Serratia proteamaculans (strain 568)
A7MEQ8 2.09e-47 150 73 0 87 3 clpS ATP-dependent Clp protease adapter protein ClpS Cronobacter sakazakii (strain ATCC BAA-894)
B2VC66 2.31e-47 150 69 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7UMX3 4.55e-47 149 71 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z3N8 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella sonnei (strain Ss046)
P0A8Q9 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella flexneri
Q0T8P4 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella flexneri serotype 5b (strain 8401)
Q32E01 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella dysenteriae serotype 1 (strain Sd197)
Q323M1 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella boydii serotype 4 (strain Sb227)
B2TUJ7 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RE41 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain UTI89 / UPEC)
B1LKM9 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain SMS-3-5 / SECEC)
B6I8V2 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain SE11)
B7NAN2 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8Q6 5.48e-47 149 68 0 95 1 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain K12)
B1IWP1 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8Q7 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJG8 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9B8 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O1:K1 / APEC
A7ZYI5 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O9:H4 (strain HS)
B1X822 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain K12 / DH10B)
C4ZY53 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M809 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O8 (strain IAI1)
B7MRT8 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O81 (strain ED1a)
B7NM96 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSH7 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8Q8 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O157:H7
B7LD74 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli (strain 55989 / EAEC)
B7MHI7 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZJU9 5.48e-47 149 68 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia coli O139:H28 (strain E24377A / ETEC)
A0KJD6 9.83e-47 148 64 0 102 3 clpS ATP-dependent Clp protease adapter protein ClpS Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7LN49 1.91e-46 147 67 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8AIK9 2.78e-46 147 67 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4SNL8 4.66e-46 146 72 0 86 3 clpS ATP-dependent Clp protease adapter protein ClpS Aeromonas salmonicida (strain A449)
P67649 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67650 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella typhi
B4TRR1 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella schwarzengrund (strain CVM19633)
B5BBT0 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella paratyphi A (strain AKU_12601)
C0PXR3 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella paratyphi C (strain RKS4594)
A9N7Z5 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGK0 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0G6 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella newport (strain SL254)
B4TD06 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella heidelberg (strain SL476)
B5QYM8 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella enteritidis PT4 (strain P125109)
B5FQ21 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella dublin (strain CT_02021853)
Q57R56 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella choleraesuis (strain SC-B67)
B5F127 5.54e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella agona (strain SL483)
A6T6X9 6.07e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYB2 6.07e-46 146 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Klebsiella pneumoniae (strain 342)
C5BEA1 7.54e-46 146 67 0 86 3 clpS ATP-dependent Clp protease adapter protein ClpS Edwardsiella ictaluri (strain 93-146)
A9MI06 1.39e-45 145 73 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4W8P9 1.96e-45 145 64 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Enterobacter sp. (strain 638)
B5R8G5 2.36e-45 144 72 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q2NTZ9 6.12e-45 144 66 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Sodalis glossinidius (strain morsitans)
B5FG65 4.03e-44 141 63 1 97 3 clpS ATP-dependent Clp protease adapter protein ClpS Aliivibrio fischeri (strain MJ11)
Q5E3Y5 4.03e-44 141 63 1 97 3 clpS ATP-dependent Clp protease adapter protein ClpS Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7N1L5 1.22e-43 140 61 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio campbellii (strain ATCC BAA-1116)
Q87QY5 1.47e-43 140 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LLJ0 2.04e-43 140 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio cholerae serotype O1 (strain M66-2)
Q9KSW3 2.04e-43 140 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F294 2.04e-43 140 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LT14 3.77e-43 139 61 1 97 3 clpS ATP-dependent Clp protease adapter protein ClpS Photobacterium profundum (strain SS9)
B6EIX3 1.55e-42 137 58 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Aliivibrio salmonicida (strain LFI1238)
Q7MJ40 2.04e-42 137 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio vulnificus (strain YJ016)
Q8DAS0 2.04e-42 137 60 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio vulnificus (strain CMCP6)
B7VM32 9.26e-42 135 59 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Vibrio atlanticus (strain LGP32)
Q081G4 1.26e-40 132 66 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella frigidimarina (strain NCIMB 400)
Q5R0C3 2.45e-40 132 62 0 86 3 clpS ATP-dependent Clp protease adapter protein ClpS Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3QD84 2.53e-40 132 64 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S7A6 1.4e-39 130 65 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A9L4G4 2.37e-39 129 64 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella baltica (strain OS195)
A6WP64 2.37e-39 129 64 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella baltica (strain OS185)
A3D5F3 2.37e-39 129 64 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E950 2.37e-39 129 64 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella baltica (strain OS223)
A1RIX2 3.92e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella sp. (strain W3-18-1)
A4Y7L6 3.92e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EDW4 4.62e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HVZ0 4.94e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella sp. (strain MR-7)
Q0HJP4 4.94e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella sp. (strain MR-4)
A0KW16 4.94e-39 129 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella sp. (strain ANA-3)
B1KIC5 5.1e-39 128 61 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella woodyi (strain ATCC 51908 / MS32)
Q15T97 6.49e-39 128 60 1 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B2FQX5 2.96e-38 127 60 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Stenotrophomonas maltophilia (strain K279a)
Q12N59 6.41e-38 125 60 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B4SIN7 9.54e-38 125 58 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Stenotrophomonas maltophilia (strain R551-3)
A8FUH3 1.05e-37 125 63 0 92 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella sediminis (strain HAW-EB3)
A1WWV6 3.72e-36 121 58 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Halorhodospira halophila (strain DSM 244 / SL1)
B0TQ07 1.69e-35 119 55 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella halifaxensis (strain HAW-EB4)
B8CLI1 2.65e-35 119 60 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H5L6 3.97e-35 119 60 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9I0L7 6.64e-35 119 60 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NB3 6.64e-35 119 60 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V4G5 6.64e-35 119 60 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas aeruginosa (strain PA7)
Q46XL9 8.02e-35 118 53 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B1JBE9 1.44e-34 118 61 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas putida (strain W619)
Q1LJB0 1.5e-34 117 53 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6FCI2 1.68e-34 117 51 1 103 3 clpS ATP-dependent Clp protease adapter protein ClpS Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88FS4 1.71e-34 117 61 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KLX7 1.71e-34 117 61 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas putida (strain GB-1)
A5W1G7 1.71e-34 117 61 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8P999 2.44e-34 117 53 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UUJ9 2.44e-34 117 53 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Xanthomonas campestris pv. campestris (strain 8004)
Q5WY89 2.8e-34 117 56 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Legionella pneumophila (strain Lens)
A5IG97 2.8e-34 117 56 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Legionella pneumophila (strain Corby)
Q5ZXB5 2.92e-34 117 56 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6T6 2.92e-34 117 56 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Legionella pneumophila (strain Paris)
Q5GZR3 3.54e-34 116 52 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Q9 3.54e-34 116 52 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PL06 3.54e-34 116 52 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Xanthomonas axonopodis pv. citri (strain 306)
B3R6C0 4.28e-34 116 52 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K793 4.28e-34 116 52 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
C3JY63 5.3e-34 116 57 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas fluorescens (strain SBW25)
A4XUY4 8.83e-34 116 60 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas mendocina (strain ymp)
Q4K9U7 9.96e-34 115 56 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0A8P0 1.33e-33 115 51 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B2UAR2 1.56e-33 115 52 0 94 3 clpS ATP-dependent Clp protease adapter protein ClpS Ralstonia pickettii (strain 12J)
Q8XWK9 1.56e-33 115 51 0 94 3 clpS ATP-dependent Clp protease adapter protein ClpS Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87ZS0 1.8e-33 115 59 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48H65 2.55e-33 115 59 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZRK6 3.04e-33 114 59 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Pseudomonas syringae pv. syringae (strain B728a)
B6INJ3 3.24e-33 114 58 0 89 3 clpS ATP-dependent Clp protease adapter protein ClpS Rhodospirillum centenum (strain ATCC 51521 / SW)
A4JH39 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BU94 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia orbicola (strain AU 1054)
B1JXD0 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia orbicola (strain MC0-3)
A9AGM9 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia multivorans (strain ATCC 17616 / 249)
Q39DM1 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BCK0 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E904 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K9U2 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia cenocepacia (strain HI2424)
B1YVB1 6.77e-33 113 52 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia ambifaria (strain MC40-6)
Q87DL8 7.59e-33 113 46 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U6Q9 7.59e-33 113 46 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Xylella fastidiosa (strain M12)
B2I9Y0 7.59e-33 113 46 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Xylella fastidiosa (strain M23)
Q607H2 9.76e-33 113 47 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B1XY29 1.08e-32 113 50 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q2T0I1 1.24e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q47BF7 1.44e-32 112 52 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Dechloromonas aromatica (strain RCB)
Q2KZI1 1.63e-32 112 51 1 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Bordetella avium (strain 197N)
A9IQ03 1.85e-32 112 51 1 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q63WJ1 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia pseudomallei (strain K96243)
A3N6N9 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia pseudomallei (strain 668)
Q3JV77 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia pseudomallei (strain 1710b)
A3NSC3 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia pseudomallei (strain 1106a)
A1V120 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia mallei (strain SAVP1)
Q62HH7 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia mallei (strain ATCC 23344)
A2S519 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia mallei (strain NCTC 10229)
A3MN51 2.02e-32 112 51 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Burkholderia mallei (strain NCTC 10247)
Q31GL7 2.41e-32 112 51 0 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C1DKZ8 2.74e-32 112 59 0 81 3 clpS ATP-dependent Clp protease adapter protein ClpS Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1U1H1 2.97e-32 112 56 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9PDD7 5.68e-32 110 46 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Xylella fastidiosa (strain 9a5c)
B2T6J4 9.06e-32 110 50 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q82TY3 9.82e-32 110 49 0 93 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8G0C9 1.14e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella suis biovar 1 (strain 1330)
B0CGW7 1.14e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M5I2 1.14e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B2S618 1.14e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella abortus (strain S19)
Q8YHI3 1.2e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJD8 1.2e-31 110 54 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Brucella melitensis biotype 2 (strain ATCC 23457)
Q13UV5 1.48e-31 110 49 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Paraburkholderia xenovorans (strain LB400)
Q5FTB0 1.74e-31 110 53 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Gluconobacter oxydans (strain 621H)
A4G7T9 2.03e-31 109 53 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Herminiimonas arsenicoxydans
B2JDY3 2.25e-31 109 49 0 95 3 clpS ATP-dependent Clp protease adapter protein ClpS Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A6T108 2.82e-31 109 53 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Janthinobacterium sp. (strain Marseille)
Q2W899 4.32e-31 109 51 1 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q0AEG2 6.59e-31 108 52 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7W7E8 7.82e-31 108 48 1 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKT7 7.82e-31 108 48 1 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VVC1 8.35e-31 108 48 1 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7NRW1 9.15e-31 108 51 0 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q480C4 1.51e-30 107 49 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2Y6T2 2.33e-30 107 48 1 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q6MNG7 2.5e-30 107 57 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q89JW5 3.77e-30 106 46 1 109 3 clpS2 ATP-dependent Clp protease adapter protein ClpS 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1K4J5 5.12e-30 105 48 0 90 3 clpS ATP-dependent Clp protease adapter protein ClpS Azoarcus sp. (strain BH72)
Q6FZM5 1.71e-29 105 48 0 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Bartonella quintana (strain Toulouse)
Q5P201 1.71e-29 104 45 0 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5NLR1 1.78e-29 104 48 0 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q6N535 3.12e-29 104 51 0 89 3 clpS2 ATP-dependent Clp protease adapter protein ClpS 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1TS63 4.68e-29 104 51 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Paracidovorax citrulli (strain AAC00-1)
Q92Q63 7.16e-29 103 51 1 96 3 clpS1 ATP-dependent Clp protease adapter protein ClpS 1 Rhizobium meliloti (strain 1021)
B0T2L1 9.95e-29 102 54 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Caulobacter sp. (strain K31)
B4R947 1.88e-28 102 54 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Phenylobacterium zucineum (strain HLK1)
B8GZM8 5.07e-28 101 52 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Caulobacter vibrioides (strain NA1000 / CB15N)
Q0C3E2 9.59e-28 100 50 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Hyphomonas neptunium (strain ATCC 15444)
Q9A5I0 1.11e-27 100 52 0 85 1 clpS ATP-dependent Clp protease adapter protein ClpS Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7HWX2 1.2e-27 100 56 0 80 3 clpS ATP-dependent Clp protease adapter protein ClpS Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q6G5D4 1.36e-27 100 45 0 98 3 clpS ATP-dependent Clp protease adapter protein ClpS Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q98MA3 2.12e-27 99 53 0 81 3 clpS1 ATP-dependent Clp protease adapter protein ClpS 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q21UT1 2.51e-27 99 50 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8UFN4 2.66e-27 99 47 1 96 3 clpS1 ATP-dependent Clp protease adapter protein ClpS 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5LMA7 2.83e-27 99 51 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GDK0 3.52e-27 99 47 0 99 3 clpS ATP-dependent Clp protease adapter protein ClpS Ruegeria sp. (strain TM1040)
A4WPY6 3.76e-27 99 44 0 105 3 clpS ATP-dependent Clp protease adapter protein ClpS Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
C5CLL8 4.45e-27 99 46 0 96 3 clpS ATP-dependent Clp protease adapter protein ClpS Variovorax paradoxus (strain S110)
Q16AR8 5.75e-27 98 45 0 101 3 clpS ATP-dependent Clp protease adapter protein ClpS Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B8DJU4 5.85e-27 98 50 0 86 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A1WRC7 1.02e-26 98 51 0 91 3 clpS ATP-dependent Clp protease adapter protein ClpS Verminephrobacter eiseniae (strain EF01-2)
Q0AQ60 5.32e-26 95 53 0 81 3 clpS ATP-dependent Clp protease adapter protein ClpS Maricaulis maris (strain MCS10)
B8FGA3 7.09e-26 95 50 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Desulfatibacillum aliphaticivorans
C0QI24 2.09e-25 94 51 0 81 3 clpS ATP-dependent Clp protease adapter protein ClpS Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q2LQK8 2.59e-25 94 46 0 86 3 clpS ATP-dependent Clp protease adapter protein ClpS Syntrophus aciditrophicus (strain SB)
Q30ZJ9 4.44e-25 93 44 0 87 3 clpS ATP-dependent Clp protease adapter protein ClpS Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1MQQ6 8.43e-25 93 45 0 87 3 clpS ATP-dependent Clp protease adapter protein ClpS Lawsonia intracellularis (strain PHE/MN1-00)
Q9JV14 1.36e-23 89 42 1 106 3 clpS ATP-dependent Clp protease adapter protein ClpS Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1VDN4 2.63e-23 89 45 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitratidesulfovibrio vulgaris (strain DP4)
Q72BN4 2.63e-23 89 45 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A3DER9 5.09e-23 88 50 0 82 3 clpS ATP-dependent Clp protease adapter protein ClpS Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5F9I5 5.12e-23 88 45 0 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A7H2Q0 7.18e-23 87 48 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q7VFW0 7.3e-23 87 41 1 106 3 clpS ATP-dependent Clp protease adapter protein ClpS Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5HTZ7 8.1e-23 87 48 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Campylobacter jejuni (strain RM1221)
Q9PNI7 8.1e-23 87 48 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6APV7 8.37e-23 87 44 2 103 3 clpS ATP-dependent Clp protease adapter protein ClpS Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1W094 1.14e-22 87 48 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FMG0 1.14e-22 87 48 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9RWS9 1.57e-22 87 45 0 80 3 clpS ATP-dependent Clp protease adapter protein ClpS Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9JZZ5 1.92e-22 86 45 0 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1CZL3 2.08e-22 87 42 0 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Myxococcus xanthus (strain DK1622)
Q7MSL3 4.02e-21 83 37 1 104 3 clpS ATP-dependent Clp protease adapter protein ClpS Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q051X7 5.05e-21 83 42 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RP4 5.05e-21 83 42 0 84 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q8F4D8 1.85e-20 82 42 0 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RD1 1.85e-20 82 42 0 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B0SS68 2.15e-20 82 46 0 81 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S9H9 2.15e-20 82 46 0 81 3 clpS ATP-dependent Clp protease adapter protein ClpS Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q6NAI2 3.07e-20 81 43 0 90 3 clpS1 ATP-dependent Clp protease adapter protein ClpS 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q97I31 3.12e-18 76 40 1 100 3 clpS ATP-dependent Clp protease adapter protein ClpS Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q73KU4 3.48e-18 75 38 1 102 3 clpS ATP-dependent Clp protease adapter protein ClpS Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q98HS2 1.51e-17 74 41 0 90 3 clpS2 ATP-dependent Clp protease adapter protein ClpS 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B9L8R5 1.36e-15 69 40 0 82 3 clpS ATP-dependent Clp protease adapter protein ClpS Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q89RX6 1.05e-14 67 37 0 83 3 clpS1 ATP-dependent Clp protease adapter protein ClpS 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q92N66 3.87e-13 63 34 0 97 3 clpS2 ATP-dependent Clp protease adapter protein ClpS 2 Rhizobium meliloti (strain 1021)
Q8UD95 1.17e-12 62 35 0 99 1 clpS2 ATP-dependent Clp protease adapter protein ClpS 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9ZN32 3.05e-12 60 35 1 88 3 clpS ATP-dependent Clp protease adapter protein ClpS Helicobacter pylori (strain J99 / ATCC 700824)
P56066 1.49e-11 58 31 0 85 3 clpS ATP-dependent Clp protease adapter protein ClpS Helicobacter pylori (strain ATCC 700392 / 26695)
Q7NML9 2e-10 55 38 3 89 3 clpS ATP-dependent Clp protease adapter protein ClpS Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q82D28 9.76e-08 49 28 1 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9S2G5 2.55e-07 48 26 1 83 3 clpS ATP-dependent Clp protease adapter protein ClpS Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5N3U1 3.16e-06 45 34 2 79 3 clpS ATP-dependent Clp protease adapter protein ClpS Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QE7 7.32e-06 44 40 3 64 3 clpS ATP-dependent Clp protease adapter protein ClpS Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9SX29 9.89e-05 42 37 3 62 1 CPLS1 ATP-dependent Clp protease adapter protein CLPS1, chloroplastic Arabidopsis thaliana
Q73X80 0.000191 40 30 1 69 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QCZ8 0.000191 40 30 1 69 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium avium (strain 104)
Q8DJY3 0.000648 39 35 1 57 3 clpS ATP-dependent Clp protease adapter protein ClpS Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P9WPC1 0.001 38 30 0 56 1 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPC0 0.001 38 30 0 56 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U231 0.001 38 30 0 56 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AMX6 0.001 38 30 0 56 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIC1 0.001 38 30 0 56 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P67648 0.001 38 30 0 56 3 clpS ATP-dependent Clp protease adapter protein ClpS Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03910
Feature type CDS
Gene clpS
Product ATP-dependent Clp protease adapter ClpS
Location 109761 - 110081 (strand: -1)
Length 321 (nucleotides) / 106 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1272
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02617 ATP-dependent Clp protease adaptor protein ClpS

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2127 Posttranslational modification, protein turnover, chaperones (O) O ATP-dependent Clp protease adapter protein ClpS

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06891 ATP-dependent Clp protease adaptor protein ClpS - -

Protein Sequence

MSHYQSESQTDVTLREKALQKIQPPSMYKVVLNNDDYTPMDFVVEVLQKFFSYNVDRATQIMLDIHYQGKGICGVFTAEIAEMKTTLVNTYAKDNDHPLLCTLEKV

Flanking regions ( +/- flanking 50bp)

AAGTATTGATACGCCTGATGTGGCGTACGTTTTCTATAACCGGAATAGCAATGAGTCACTATCAATCTGAATCACAAACGGATGTCACGCTCAGGGAAAAAGCGCTGCAGAAGATACAGCCACCGTCAATGTACAAGGTGGTTTTAAACAACGACGACTATACCCCTATGGACTTTGTGGTTGAAGTTTTACAAAAGTTCTTTTCTTATAATGTTGATCGTGCGACGCAGATTATGCTCGACATCCATTATCAGGGAAAAGGGATCTGCGGGGTATTTACCGCTGAAATCGCTGAAATGAAAACAACACTGGTCAATACGTACGCGAAAGACAACGATCATCCGTTGCTGTGTACACTCGAGAAGGTATAAGAATACACTTTGTTTCTCTGAATGGAGGTGCCTATGCTCAATCAAGAATT