Homologs in group_2603

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02835 FBDBKF_02835 100.0 Morganella morganii S1 azlD2 Branched-chain amino acid transport protein
NLDBIP_00155 NLDBIP_00155 100.0 Morganella morganii S4 azlD2 Branched-chain amino acid transport protein
LHKJJB_01880 LHKJJB_01880 100.0 Morganella morganii S3 azlD2 Branched-chain amino acid transport protein
HKOGLL_01920 HKOGLL_01920 100.0 Morganella morganii S5 azlD2 Branched-chain amino acid transport protein
F4V73_RS05275 F4V73_RS05275 91.3 Morganella psychrotolerans - AzlD domain-containing protein

Distribution of the homologs in the orthogroup group_2603

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2603

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03305
Feature type CDS
Gene azlD2
Product Branched-chain amino acid transport protein
Location 650155 - 650466 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2603
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF05437 Branched-chain amino acid transport protein (AzlD)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4392 Amino acid transport and metabolism (E) E Branched-chain amino acid transport protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K26606 branched chain amino acid efflux pump - -

Protein Sequence

MSWGLIFALTLMLFSLRFIFLIPGLPLRLPVFIQQALTYSAPCLLVAICAPIVLLEEQQFRDISDNPYLWGTLFCIIAARLIKNTLLTVILTLVFFYTLIYLF

Flanking regions ( +/- flanking 50bp)

AGCGCCATGCTGCTGGCCGTTCTGCTGGGGCGTAAATGGGGGGATGTAAAATGAGCTGGGGATTAATATTCGCACTGACGCTGATGCTGTTTTCGCTGCGCTTTATTTTTCTGATCCCGGGATTACCGCTGCGGCTTCCGGTCTTTATTCAGCAGGCCCTGACCTATTCCGCGCCCTGTCTGCTGGTGGCTATTTGCGCGCCGATTGTATTACTGGAGGAACAACAGTTCCGTGATATCAGTGATAATCCGTATTTATGGGGTACGCTGTTCTGTATTATCGCCGCACGGCTGATTAAAAATACCCTGCTGACCGTGATCCTGACGCTGGTATTTTTCTACACCCTGATTTATCTGTTCTGATTATGTAACTATCCGCACCGGAAACCCGGTGCGGAATTCAGAGAACGTTA