Homologs in group_2548

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02530 FBDBKF_02530 100.0 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_00460 NLDBIP_00460 100.0 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
LHKJJB_01575 LHKJJB_01575 100.0 Morganella morganii S3 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
HKOGLL_01615 HKOGLL_01615 100.0 Morganella morganii S5 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
F4V73_RS04955 F4V73_RS04955 85.5 Morganella psychrotolerans - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_2548

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2548

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34805 1.85e-25 106 28 8 269 3 yvrC Uncharacterized ABC transporter substrate-binding lipoprotein YvrC Bacillus subtilis (strain 168)
A7MXP0 1.1e-20 92 26 10 291 3 btuF Vitamin B12-binding protein Vibrio campbellii (strain ATCC BAA-1116)
Q87SE7 6.15e-20 90 26 9 288 3 btuF Vitamin B12-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LQF3 3.75e-16 80 22 6 254 3 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain M66-2)
Q9KPI6 3.75e-16 80 22 6 254 3 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5P5 3.75e-16 80 22 6 254 1 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P37028 2.05e-14 75 26 9 295 1 btuF Vitamin B12-binding protein Escherichia coli (strain K12)
Q83MD7 3.12e-14 74 26 9 295 3 btuF Vitamin B12-binding protein Shigella flexneri
Q8CWD2 3.87e-14 74 26 9 295 3 btuF Vitamin B12-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8Z0 5.66e-14 73 25 9 295 3 btuF Vitamin B12-binding protein Escherichia coli O157:H7
Q6D1Z3 6.94e-14 73 27 3 147 3 btuF Vitamin B12-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q56991 2e-13 72 28 9 248 1 hmuT Hemin-binding periplasmic protein HmuT Yersinia pestis
C6DC28 3.14e-13 72 25 8 255 3 btuF Vitamin B12-binding protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7N842 3.62e-13 71 30 2 136 3 btuF Vitamin B12-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q57T49 1.87e-12 69 26 9 273 3 btuF Vitamin B12-binding protein Salmonella choleraesuis (strain SC-B67)
Q66EE7 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPX1 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pestis (strain Pestoides F)
Q1CLU2 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E1 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM3 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pestis
B2K552 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X6 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM05 2.1e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JK18 2.48e-12 69 23 5 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZRP7 2.57e-12 68 26 9 273 3 btuF Vitamin B12-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PD47 5.09e-12 68 26 9 273 3 btuF Vitamin B12-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z9B2 1.32e-11 67 26 10 275 3 btuF Vitamin B12-binding protein Salmonella typhi
Q7MNT2 2.22e-11 66 23 6 261 3 btuF Vitamin B12-binding protein Vibrio vulnificus (strain YJ016)
Q8DEM7 3.75e-11 65 23 6 261 3 btuF Vitamin B12-binding protein Vibrio vulnificus (strain CMCP6)
Q9HQ20 6.62e-11 65 23 9 276 1 btuF Cobalamin-binding protein Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G2 6.62e-11 65 23 9 276 3 btuF Cobalamin-binding protein Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q6LUR6 1.76e-10 63 20 7 265 3 btuF Vitamin B12-binding protein Photobacterium profundum (strain SS9)
Q47084 1.81e-09 61 23 7 262 3 cbrA Achromobactin-binding periplasmic protein Dickeya dadantii (strain 3937)
O31567 2.77e-06 51 23 9 254 1 yfiY Probable siderophore-binding lipoprotein YfiY Bacillus subtilis (strain 168)
O34348 1.3e-05 49 24 7 199 2 yfmC Fe(3+)-citrate-binding protein YfmC Bacillus subtilis (strain 168)
C0SP94 0.000528 44 23 9 246 1 yhfQ Putative ABC transporter substrate-binding lipoprotein YhfQ Bacillus subtilis (strain 168)
P11460 0.000625 44 25 4 140 1 fatB Ferric-anguibactin-binding protein FatB Vibrio anguillarum (strain ATCC 68554 / 775)
Q81L65 0.000831 44 22 8 223 1 fpuA Petrobactin-binding protein FpuA Bacillus anthracis

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03000
Feature type CDS
Gene fepB
Product ABC-type Fe3+-hydroxamate transport system, periplasmic component
Location 592181 - 593092 (strand: 1)
Length 912 (nucleotides) / 303 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2548
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01497 Periplasmic binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0614 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-hydroxamate transport system, periplasmic component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02016 iron complex transport system substrate-binding protein - -

Protein Sequence

MKVLTLIITLSMALCHALPAFSMMAQLSAPVTLNEKPQRIVTIFSSNTEIVAILGLADNIAGIDAYTYFPDEIKNKPLIGGRLGFSLERIIELKPDLVIMTPARQATHQLLTPLRKFGIPVLVLEGNSIEEIIRNIRLVAQVTKTTEKGEQVAAEMEQRLHNVQQKPAGYRAPRVIMITGQVSNGLLLVARPQAYKKTPGYTADSILKAGGTLALEEYKQAGPALKQVSPEAVIAADPDIILYTISGDKIRDLLTLPGWSQMKAVKNNDIYPVKSAYVLIPGPRIIDGIEYMSDIFVQWSLRQ

Flanking regions ( +/- flanking 50bp)

CGGGCCGGTCATTTATTGCCGGTGTGACATACCGTTTTTAACCGGCAATAATGAAAGTCCTGACTCTTATTATCACACTGAGCATGGCCCTGTGCCATGCTCTGCCTGCTTTCAGTATGATGGCGCAATTATCTGCGCCGGTCACACTGAACGAAAAACCGCAGCGTATTGTGACTATCTTTTCATCAAATACCGAAATTGTGGCTATCCTCGGACTGGCTGACAATATCGCCGGTATTGATGCCTATACCTATTTTCCCGATGAAATCAAAAATAAACCGTTAATCGGCGGCCGCCTCGGGTTTTCTCTTGAGCGGATCATTGAACTGAAACCGGATCTGGTGATTATGACCCCTGCCCGCCAGGCCACGCATCAGTTATTAACACCGCTGCGCAAATTCGGCATTCCTGTGCTGGTACTGGAGGGAAACAGTATTGAGGAAATTATCCGTAATATCCGTCTGGTGGCACAGGTCACCAAAACAACGGAAAAAGGCGAACAGGTGGCGGCGGAGATGGAACAGCGGTTGCACAATGTTCAGCAAAAGCCCGCCGGTTACCGCGCACCAAGGGTCATTATGATCACCGGTCAGGTTAGTAACGGGTTATTACTGGTTGCCAGGCCGCAGGCGTATAAAAAAACACCGGGATATACCGCCGATTCCATTTTAAAAGCAGGCGGAACCCTGGCGCTGGAGGAATATAAACAGGCCGGACCGGCGCTGAAACAGGTATCTCCGGAAGCGGTTATCGCCGCCGACCCGGATATTATTTTGTACACCATTTCCGGAGACAAAATCCGGGATTTACTGACACTTCCCGGCTGGTCACAAATGAAAGCTGTTAAAAATAATGATATTTATCCGGTCAAAAGTGCATATGTGCTTATTCCCGGCCCGCGGATTATTGATGGCATTGAATATATGTCTGACATCTTTGTGCAATGGAGCCTGAGACAGTGAAAATAGTCAGTCTGTTACTCATTCTCTTCGCTGCATTTATTTTCTCTGCC