Homologs in group_2500

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01825 FBDBKF_01825 100.0 Morganella morganii S1 - Type II toxin-antitoxin system death-on-curing family toxin
NLDBIP_01165 NLDBIP_01165 100.0 Morganella morganii S4 - Type II toxin-antitoxin system death-on-curing family toxin
LHKJJB_00870 LHKJJB_00870 100.0 Morganella morganii S3 - Type II toxin-antitoxin system death-on-curing family toxin
HKOGLL_00910 HKOGLL_00910 100.0 Morganella morganii S5 - Type II toxin-antitoxin system death-on-curing family toxin
F4V73_RS04150 F4V73_RS04150 88.8 Morganella psychrotolerans - type II toxin-antitoxin system death-on-curing family toxin

Distribution of the homologs in the orthogroup group_2500

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2500

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q06259 2.42e-20 83 38 1 121 1 doc Protein kinase doc Escherichia phage P1
A0QRY0 4.61e-05 43 35 1 71 1 doc Toxin Doc Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_02295
Feature type CDS
Gene -
Product Type II toxin-antitoxin system death-on-curing family toxin
Location 440517 - 440921 (strand: 1)
Length 405 (nucleotides) / 134 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2500
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02661 Fic/DOC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3654 Mobilome: prophages, transposons (X) X Prophage maintenance system killer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07341 death on curing protein - -

Protein Sequence

MTIRFLTVDEVVEIQRSTLPNSGKPDLSKLEGALSRIEALRDYEECEDIFKFSAMYLISIAKAHAFNDANKRTAFQAASVFLILNGVELNVSMELVKLTILAATGEAERDTAAFVLKVLSDYHNDLLEETTGGY

Flanking regions ( +/- flanking 50bp)

AGAACGAAAACAAAACACGCTGACATCATCAGAGCGCTGGAAGACAAATAATGACTATCCGATTTCTGACAGTTGATGAAGTGGTTGAAATACAGCGCTCAACACTGCCGAACAGCGGTAAACCGGATCTCAGCAAACTGGAAGGGGCGTTATCCCGTATTGAGGCATTGCGGGATTATGAGGAGTGTGAGGATATTTTTAAGTTCTCTGCCATGTACCTGATTTCAATTGCCAAAGCGCATGCTTTTAATGATGCAAATAAAAGAACGGCTTTCCAGGCAGCCAGTGTGTTTCTGATACTGAACGGCGTTGAACTTAATGTCTCTATGGAACTGGTCAAGCTGACCATACTGGCAGCCACCGGAGAAGCGGAACGCGATACAGCAGCGTTTGTTCTCAAAGTATTGTCCGATTATCACAACGACCTGCTTGAAGAGACAACCGGCGGATATTAAAAAGGGCACTTTTCAGTGCCCGTTTTGCTGATTGCGCTGACTTTTCTCAG