Homologs in group_2531

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01825 FBDBKF_01825 88.8 Morganella morganii S1 - Type II toxin-antitoxin system death-on-curing family toxin
EHELCC_02295 EHELCC_02295 88.8 Morganella morganii S2 - Type II toxin-antitoxin system death-on-curing family toxin
NLDBIP_01165 NLDBIP_01165 88.8 Morganella morganii S4 - Type II toxin-antitoxin system death-on-curing family toxin
LHKJJB_00870 LHKJJB_00870 88.8 Morganella morganii S3 - Type II toxin-antitoxin system death-on-curing family toxin
HKOGLL_00910 HKOGLL_00910 88.8 Morganella morganii S5 - Type II toxin-antitoxin system death-on-curing family toxin

Distribution of the homologs in the orthogroup group_2531

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2531

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q06259 1.89e-19 80 36 2 121 1 doc Protein kinase doc Escherichia phage P1
A0QRY0 0.000148 42 40 0 47 1 doc Toxin Doc Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04150
Feature type CDS
Gene -
Product type II toxin-antitoxin system death-on-curing family toxin
Location 876911 - 877318 (strand: 1)
Length 408 (nucleotides) / 135 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2531
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02661 Fic/DOC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3654 Mobilome: prophages, transposons (X) X Prophage maintenance system killer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07341 death on curing protein - -

Protein Sequence

MMDLRFLTVDEVIEIQKSTLPNSGKPNIAKLEGALSRIETLRDYEHCDDIFKFSAMYLISIAKAHAFNDANKRTAFQAASVFLILNGIELNVSMELVKLTILAAMGEAECDTAAFTLKVLSDYHNDLLEETTNGY

Flanking regions ( +/- flanking 50bp)

GATAAAACGAAGATCAAACATGCGGATATTATCAGGGCACTGGAAGATAAATGATGGACCTGAGATTTCTGACCGTTGATGAAGTCATAGAGATACAAAAATCGACATTACCCAATAGCGGAAAGCCGAATATAGCTAAATTGGAAGGCGCTCTCTCCCGGATTGAGACATTAAGGGATTATGAGCACTGTGATGATATATTTAAATTTTCCGCAATGTATTTGATTTCAATTGCAAAAGCTCATGCTTTTAATGATGCGAATAAAAGGACGGCATTTCAGGCGGCCAGTGTGTTCCTGATACTCAATGGTATTGAACTGAATGTATCTATGGAGTTGGTCAAACTGACAATATTGGCGGCAATGGGTGAAGCTGAGTGTGATACAGCGGCATTCACCCTGAAAGTGTTATCTGATTATCATAACGATCTGCTTGAAGAGACAACCAACGGCTATTAGCAATAGCGGTTAGTACAATACTAAAAAACAAAAAACGGGAACCTTAGGTT