Homologs in group_588

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01715 FBDBKF_01715 100.0 Morganella morganii S1 yeaO DUF488 domain-containing protein
NLDBIP_01275 NLDBIP_01275 100.0 Morganella morganii S4 yeaO DUF488 domain-containing protein
LHKJJB_00760 LHKJJB_00760 100.0 Morganella morganii S3 yeaO DUF488 domain-containing protein
HKOGLL_00800 HKOGLL_00800 100.0 Morganella morganii S5 yeaO DUF488 domain-containing protein
F4V73_RS04045 F4V73_RS04045 88.8 Morganella psychrotolerans - DUF488 family protein
PMI_RS14490 PMI_RS14490 58.3 Proteus mirabilis HI4320 - DUF488 family protein

Distribution of the homologs in the orthogroup group_588

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_588

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76243 2.34e-32 112 51 0 110 4 yeaO Uncharacterized protein YeaO Escherichia coli (strain K12)
P65064 3.7e-20 82 40 2 112 4 BQ2027_MB3100C Uncharacterized protein Mb3100c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WL11 3.7e-20 82 40 2 112 4 Rv3073c Uncharacterized protein Rv3073c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WL10 3.7e-20 82 40 2 112 4 MT3158 Uncharacterized protein MT3158 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_02185
Feature type CDS
Gene yeaO
Product DUF488 domain-containing protein
Location 420238 - 420588 (strand: 1)
Length 351 (nucleotides) / 116 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_588
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF22752 Inactive DUF488-N3 subclade

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3189 Function unknown (S) S Uncharacterized conserved protein YeaO, DUF488 family

Protein Sequence

MIFCKRVYDEVAESDGYRVLVDRLWPRGIKKTDLNYDEWNKDVAPDTELRKWFHANSDQFPEFERRYREELESRPQSWQPLVARAVQGNLTLLFAAKDKEHNQAKVLKAFLEEKLS

Flanking regions ( +/- flanking 50bp)

CGCAAAGCCTGGTTACTGGCTCATGAAAAACAGGTTAAAGGAGCATCAGCATGATTTTCTGTAAACGGGTTTATGATGAGGTCGCGGAAAGTGACGGTTACCGGGTACTGGTTGACCGGTTGTGGCCGCGCGGAATTAAAAAAACCGATCTGAATTACGATGAATGGAATAAGGATGTTGCGCCGGATACGGAATTACGCAAGTGGTTCCACGCTAACAGTGATCAGTTTCCGGAGTTTGAACGGCGTTACCGTGAAGAGCTGGAGAGCAGGCCGCAAAGCTGGCAACCGCTGGTGGCCAGAGCGGTGCAGGGCAATCTGACACTGTTGTTTGCGGCAAAAGATAAAGAACATAACCAGGCTAAAGTGCTGAAGGCATTTCTGGAAGAAAAATTATCCTGATGACATATCGGCGGCCTGACTGACGCGCAGGTACAGGCAGACAGGCGAAC