Homologs in group_488

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00835 FBDBKF_00835 100.0 Morganella morganii S1 dsrB protein DsrB
NLDBIP_02750 NLDBIP_02750 100.0 Morganella morganii S4 dsrB protein DsrB
LHKJJB_04265 LHKJJB_04265 100.0 Morganella morganii S3 dsrB protein DsrB
HKOGLL_02780 HKOGLL_02780 100.0 Morganella morganii S5 dsrB protein DsrB
F4V73_RS06825 F4V73_RS06825 82.8 Morganella psychrotolerans dsrB protein DsrB
PMI_RS08175 PMI_RS08175 64.1 Proteus mirabilis HI4320 dsrB protein DsrB

Distribution of the homologs in the orthogroup group_488

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_488

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6D9C1 2.74e-21 80 58 0 62 3 dsrB Protein DsrB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D6J8 5.14e-20 77 56 0 62 3 dsrB Protein DsrB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q669S1 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLL3 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pestis (strain Pestoides F)
Q1CI78 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0J7 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFN8 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pestis
B2K6E4 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6U2 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FH79 4.5e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JI88 4.75e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A1JTB7 5.92e-19 75 56 0 60 3 dsrB Protein DsrB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NTL2 1.08e-18 74 58 0 60 3 dsrB Protein DsrB Sodalis glossinidius (strain morsitans)
B5XPV7 1.68e-17 71 58 0 58 3 dsrB Protein DsrB Klebsiella pneumoniae (strain 342)
A4WBY2 2.35e-17 70 56 0 58 3 dsrB Protein DsrB Enterobacter sp. (strain 638)
Q83KN1 5.3e-17 70 56 0 58 3 dsrB Protein DsrB Shigella flexneri
Q0T3H9 5.3e-17 70 56 0 58 3 dsrB Protein DsrB Shigella flexneri serotype 5b (strain 8401)
A9MMJ6 5.89e-17 70 55 0 58 3 dsrB Protein DsrB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AF74 1.12e-16 69 55 0 58 3 dsrB Protein DsrB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0C0T3 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5R1 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella typhi
Q5PLI6 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SW90 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella newport (strain SL254)
B4T8T9 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella heidelberg (strain SL476)
B5R7E9 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0A0 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella enteritidis PT4 (strain P125109)
Q57N17 1.24e-16 69 55 0 58 3 dsrB Protein DsrB Salmonella choleraesuis (strain SC-B67)
Q3Z0N6 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Shigella sonnei (strain Ss046)
Q32HI7 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Shigella dysenteriae serotype 1 (strain Sd197)
Q322Q2 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Shigella boydii serotype 4 (strain Sb227)
B2TXI8 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RAI9 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain UTI89 / UPEC)
B1LQQ6 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain SMS-3-5 / SECEC)
B6I0Z9 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain SE11)
B7NBU5 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AEG8 1.47e-16 68 55 0 58 2 dsrB Protein DsrB Escherichia coli (strain K12)
B1IZV7 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AEG9 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGP2 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A1F4 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O9:H4 (strain HS)
B1X6A6 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain K12 / DH10B)
C4ZQM6 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M392 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O8 (strain IAI1)
B7MWE0 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O81 (strain ED1a)
B7NRC9 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSI2 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AEH0 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O157:H7
B7L8W4 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli (strain 55989 / EAEC)
B7MCK8 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7USW6 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZN75 1.47e-16 68 55 0 58 3 dsrB Protein DsrB Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LTN9 8.5e-16 67 53 0 58 3 dsrB Protein DsrB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00710
Feature type CDS
Gene dsrB
Product protein DsrB
Location 155418 - 155612 (strand: 1)
Length 195 (nucleotides) / 64 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_488
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10781 Dextransucrase DSRB

Protein Sequence

MQIDDTVYVKTDADEPREGRILLIEPFSEGVMYLVALPEYPEGIWFFNEKEGGDGVFITPKNNF

Flanking regions ( +/- flanking 50bp)

TACCTGATTTTTATACTGATCACGCTATCGTGACGACCGGGAGCCGGATGATGCAGATTGACGACACAGTTTATGTCAAAACCGATGCGGATGAGCCGCGTGAAGGCCGGATATTGCTGATCGAACCGTTCAGTGAAGGTGTGATGTATCTGGTGGCGTTACCGGAATATCCGGAGGGAATTTGGTTTTTTAATGAAAAAGAGGGCGGGGATGGTGTATTCATCACGCCGAAAAATAATTTCTGACTTTACATATTTTCGCGGACATCCTATACTCCGCGCATCTTTTCTGAACA