Homologs in group_555

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01390 FBDBKF_01390 100.0 Morganella morganii S1 yfhL YfhL family 4Fe-4S dicluster ferredoxin
NLDBIP_03305 NLDBIP_03305 100.0 Morganella morganii S4 yfhL YfhL family 4Fe-4S dicluster ferredoxin
LHKJJB_04820 LHKJJB_04820 100.0 Morganella morganii S3 yfhL YfhL family 4Fe-4S dicluster ferredoxin
HKOGLL_02225 HKOGLL_02225 100.0 Morganella morganii S5 yfhL YfhL family 4Fe-4S dicluster ferredoxin
F4V73_RS02005 F4V73_RS02005 95.3 Morganella psychrotolerans - YfhL family 4Fe-4S dicluster ferredoxin
PMI_RS09295 PMI_RS09295 86.0 Proteus mirabilis HI4320 - YfhL family 4Fe-4S dicluster ferredoxin

Distribution of the homologs in the orthogroup group_555

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_555

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52102 6e-48 149 81 0 86 1 yfhL Ferredoxin YfhL Escherichia coli (strain K12)
P44746 9.45e-42 134 72 0 86 1 HI_0527 Uncharacterized ferredoxin-like protein HI_0527 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P00208 1.06e-26 96 61 1 77 1 fdx Ferredoxin Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
A9FH21 6.54e-25 92 55 1 84 1 sce8005 Ferredoxin Fdx2 Sorangium cellulosum (strain So ce56)
Q8KCZ7 1.26e-15 67 53 0 56 3 CT1260 Ferredoxin-2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8KCZ6 1.02e-14 65 56 0 55 3 CT1261 Ferredoxin-1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P00206 1.23e-14 65 54 0 55 1 None Ferredoxin-2 Chlorobium limicola
P00207 1.27e-14 65 51 0 58 1 fer1 Ferredoxin-1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P27394 2.61e-14 64 45 0 60 4 frxA Ferredoxin-like protein in nif region Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8KBP9 3.46e-14 63 56 0 55 3 CT1736 Ferredoxin-3 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P11054 4.05e-12 59 45 0 62 4 None Ferredoxin-like protein in nif region Azotobacter vinelandii
P00204 1.58e-11 57 55 1 54 1 None Ferredoxin-1 Chlorobium limicola
P12712 3.58e-11 56 41 0 58 4 fdxN Ferredoxin-like protein in nif region Rhizobium meliloti (strain 1021)
P42711 3.78e-11 56 39 0 58 4 fdxN Ferredoxin-like protein in nif region Rhizobium leguminosarum bv. trifolii
P00205 1.25e-10 54 60 0 45 1 None Ferredoxin Chlorobaculum thiosulfatiphilum
Q53204 1.63e-09 52 41 0 58 4 fdxN Ferredoxin-like protein in nif region Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P00198 1.94e-09 51 48 1 56 1 fdxA 4Fe-4S ferredoxin FdxA Gottschalkia acidurici (strain ATCC 7906 / DSM 604 / BCRC 14475 / CIP 104303 / KCTC 5404 / NCIMB 10678 / 9a)
P07508 1.73e-08 49 47 1 55 1 None Ferredoxin Acetivibrio thermocellus
D5ARY6 2.02e-08 49 45 1 61 1 fdxN Ferredoxin-1 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CY90 2.02e-08 49 45 1 61 3 fdxN Ferredoxin-1 Rhodobacter capsulatus
P00195 5.39e-08 48 42 1 56 1 None Ferredoxin Clostridium pasteurianum
P00197 1.06e-07 47 45 1 55 1 None Ferredoxin Clostridium sp. (strain M-E)
P80168 1.93e-07 46 42 1 56 1 CLOST_2292 Ferredoxin Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
P00200 4.75e-07 45 42 1 54 1 None Ferredoxin Thermoanaerobacterium thermosaccharolyticum
P00194 1.09e-06 44 41 1 55 1 None Ferredoxin-1 Rhodospirillum rubrum
P22846 2.13e-06 43 39 1 56 1 fer Ferredoxin Clostridium perfringens (strain 13 / Type A)
P00196 6.25e-06 42 36 1 55 1 None Ferredoxin Clostridium butyricum
P14073 8.84e-06 42 46 1 54 1 None Ferredoxin Butyribacterium methylotrophicum
P12415 9.32e-06 43 35 2 67 4 fdxN Ferredoxin-like protein in nif region Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0A3D4 2.64e-05 42 35 2 67 4 fdxN Ferredoxin-like protein in nif region Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P0A3D5 2.64e-05 42 35 2 67 4 fdxN Ferredoxin-like protein in nif region Trichormus azollae
Q2NA74 0.000241 40 34 5 93 3 nuoI NADH-quinone oxidoreductase subunit I Erythrobacter litoralis (strain HTCC2594)
Q1GTK7 0.000286 40 34 5 93 3 nuoI NADH-quinone oxidoreductase subunit I Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q2G5Z4 0.000402 40 34 5 93 3 nuoI NADH-quinone oxidoreductase subunit I Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P00193 0.000438 38 43 3 55 1 None Ferredoxin Peptoniphilus asaccharolyticus
O21233 0.000637 39 33 5 93 3 NAD8 NADH-ubiquinone oxidoreductase subunit 8 Reclinomonas americana
P06123 0.000662 37 38 2 57 4 None Ferredoxin-like protein in vnf region Azotobacter chroococcum mcd 1
Q9FX83 0.000726 39 33 5 93 1 At1g16700 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial Arabidopsis thaliana
P81293 0.000797 39 34 1 66 4 MJ0514.2 Uncharacterized polyferredoxin-like protein MJ0514.2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P80269 0.000889 39 33 5 93 1 None NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial Solanum tuberosum
Q42599 0.000894 39 33 5 93 1 At1g79010 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00155
Feature type CDS
Gene yfhL
Product YfhL family 4Fe-4S dicluster ferredoxin
Location 35636 - 35896 (strand: -1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_555
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00037 4Fe-4S binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2768 Function unknown (S) S Uncharacterized Fe-S cluster protein

Protein Sequence

MALLITERCINCDMCEPECPNEAISMGDSIYEINPDLCTECVGHYDKPTCQSVCPITNTIIIDPEHTETQEMLWDKFVLMYHADKI

Flanking regions ( +/- flanking 50bp)

GCAAGATATAAGTTACTGAATTTTAAATAATTTATATGGTGATAGCGATTATGGCGTTACTGATTACCGAACGTTGCATAAACTGCGATATGTGCGAACCTGAGTGCCCTAATGAAGCGATTTCAATGGGGGATTCTATCTATGAAATTAATCCTGATTTATGTACTGAGTGTGTCGGGCATTATGATAAACCGACCTGCCAGTCAGTCTGTCCGATTACCAACACCATTATTATCGATCCTGAGCATACCGAAACACAGGAAATGCTGTGGGATAAATTTGTGCTGATGTATCACGCCGATAAGATTTAAGCGTAATGATGCGCCCGCAAAGGGCGCATCTGTCAGGTGTTTGTTTCGAG