Homologs in group_4950
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q07591 | 6.96e-06 | 45 | 41 | 0 | 68 | 3 | eae | Intimin | Citrobacter freundii |
| P19809 | 1.8e-05 | 44 | 40 | 0 | 75 | 1 | eae | Intimin | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
| P52869 | 0.000364 | 40 | 39 | 0 | 66 | 3 | eaeA | Intimin (Fragment) | Hafnia alvei |
| O31000 | 0.0008 | 39 | 38 | 1 | 72 | 3 | eae | Intimin | Escherichia coli O111:H- |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS19225 |
| Feature type | CDS |
| Gene | - |
| Product | Ig-like domain-containing protein |
| Location | 552917 - 553177 (strand: 1) |
| Length | 261 (nucleotides) / 86 (amino acids) |
| In genomic island | - |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4950 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF02369 | Bacterial Ig-like domain (group 1) |
|---|
MADSTDTVTITLNYTKGSSPVEGATVNWSTTGGKLSVTSSKTGKAGGATVKLTSDSQGEFIVTATVDGVAQNTDAITFTEKTSPDE
CTGACTGCCGAAGAGGGAAAGTAACCCTGTCAGCGGATAAAACGTCCGCTATCGCTGACAGTACAGATACAGTAACGATCACTCTTAATTACACCAAGGGCAGCTCTCCAGTCGAAGGAGCTACCGTTAATTGGTCTACAACAGGTGGCAAATTAAGCGTTACTTCATCTAAGACGGGCAAAGCTGGTGGTGCGACAGTGAAATTAACTTCTGATTCACAGGGTGAATTTATTGTCACAGCCACTGTTGATGGTGTTGCACAAAATACTGATGCAATTACATTCACAGAAAAAACTTCTCCAGACGAGTAATTTAAGGGGCTTTGTGCCCCTCTTTTTTTTGAGGTGAGCATGATTGATCC
