Homologs in group_4825

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACG3 2.57e-11 61 34 2 135 1 stpA DNA-binding protein StpA Shigella flexneri
P0ACG1 2.57e-11 61 34 2 135 1 stpA DNA-binding protein StpA Escherichia coli (strain K12)
P0ACG2 2.57e-11 61 34 2 135 3 stpA DNA-binding protein StpA Escherichia coli O157:H7
P0DOA5 3.27e-11 60 35 5 134 1 hns DNA-binding protein H-NS Yersinia enterocolitica
Q9L5H8 2.18e-10 58 40 6 107 1 hns DNA-binding protein H-NS, plasmid Salmonella typhi
P43841 2.24e-09 56 34 6 147 3 hns DNA-binding protein H-NS homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P18818 2.75e-09 55 34 6 134 3 hns DNA-binding protein H-NS Proteus vulgaris
P0A1S4 5.48e-09 55 34 3 132 3 stpA DNA-binding protein StpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S5 5.48e-09 55 34 3 132 3 stpA DNA-binding protein StpA Salmonella typhi
P18955 1.03e-06 48 34 5 134 3 hns DNA-binding protein H-NS Serratia marcescens
P09120 1.04e-05 46 35 3 131 1 hns DNA-binding protein H-NS Shigella flexneri
P0ACF8 1.04e-05 46 35 3 131 1 hns DNA-binding protein H-NS Escherichia coli (strain K12)
P0ACF9 1.04e-05 46 35 3 131 3 hns DNA-binding protein H-NS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACG0 1.04e-05 46 35 3 131 3 hns DNA-binding protein H-NS Escherichia coli O157:H7
P0A1S2 0.000657 41 33 4 134 1 hns DNA-binding protein H-NS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NBY9 0.000657 41 33 4 134 1 hns DNA-binding protein H-NS Salmonella typhimurium (strain SL1344)
P0A1S3 0.000657 41 33 4 134 3 hns DNA-binding protein H-NS Salmonella typhi
A0A0F6B244 0.000657 41 33 4 134 1 hns DNA-binding protein H-NS Salmonella typhimurium (strain 14028s / SGSC 2262)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18630
Feature type CDS
Gene -
Product H-NS family nucleoid-associated regulatory protein
Location 20507 - 21022 (strand: 1)
Length 516 (nucleotides) / 171 (amino acids)
In genomic island -

Contig

Accession NC_010555
Length 36289 nucleotides
Topology circular
Plasmid True

Orthology

Orthogroup group_4825
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF00816 H-NS histone C-terminal domain
PF22470 H-NS histone-like proteins, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2916 Transcription (K) K DNA-binding protein H-NS

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03746 DNA-binding protein H-NS - -

Protein Sequence

MSELTREEKYKITSESLTGLTELRKFAKTKNFEWLENLANQLNGIVEEQREEFELRKLELAELEEKRLKAIKYLEELGLDPETIHISVFETTDKKGKKRKSKNTPAKYRFTHPETGKTDTWTGIGRMKKGLQLLIDAGHSLDEFLIDKASDAKDDIKEAEKLFENHPSSLG

Flanking regions ( +/- flanking 50bp)

AAGTAACTATTATTTTTTAACAGAAAACCATTTTTATATTGAGGTAAAACATGAGCGAATTAACTAGAGAAGAAAAATACAAAATTACGTCTGAATCACTGACGGGATTAACAGAGCTAAGAAAGTTTGCAAAAACGAAAAATTTTGAATGGTTAGAAAATCTTGCCAATCAACTCAATGGTATTGTAGAAGAACAGCGTGAAGAATTCGAGTTACGCAAACTTGAACTTGCTGAACTGGAAGAAAAACGCCTAAAAGCGATTAAATACTTAGAAGAGTTGGGGTTAGATCCAGAAACAATCCACATTTCCGTTTTTGAAACAACCGATAAAAAAGGAAAGAAAAGAAAGTCTAAAAATACGCCTGCGAAATATCGCTTTACGCATCCCGAAACAGGTAAAACAGACACATGGACGGGAATTGGTCGTATGAAGAAAGGATTGCAACTATTAATTGATGCAGGTCATTCTCTCGATGAATTTTTGATTGATAAAGCCAGCGATGCTAAAGATGACATTAAAGAAGCGGAAAAACTCTTTGAAAATCACCCTTCTTCGTTGGGTTAATCTCCCTCTCCTGCTGTCTCTTACATTGCCTGTTATCGGGCAATGTAAGC