Homologs in group_4749
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS18550 |
| Feature type | CDS |
| Gene | - |
| Product | conjugal transfer protein |
| Location | 3364 - 3588 (strand: 1) |
| Length | 225 (nucleotides) / 74 (amino acids) |
| Accession | NC_010555 |
|---|---|
| Length | 36289 nucleotides |
| Topology | circular |
| Plasmid | True |
| Orthogroup | group_4749 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF04956 | TrbC/VIRB2 pilin |
|---|
MVEPALAAGVDTASTGILQKWIDWLVGIRGAAITLAVIAGALIILFARKYIGFLWGIGFAIFLFVIAPYVKDWL
ACAGTAAAAAAATATTTGCACTTTTCATGATGGTTTTTATGGGGCTGTTTATGGTTGAACCCGCTCTTGCCGCAGGGGTTGATACTGCATCAACAGGGATTCTCCAAAAATGGATTGATTGGTTAGTCGGGATTCGGGGAGCCGCTATTACACTGGCAGTAATTGCAGGGGCATTGATTATACTGTTTGCCCGTAAATATATCGGTTTTCTGTGGGGGATTGGTTTTGCTATTTTCCTCTTTGTGATTGCCCCTTACGTGAAAGACTGGCTGTAATTTAAAAATGAGGGCGGATTTATGAGTGTTGTTTTTAAAGGATTAACCCG
