Homologs in group_708

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03070 FBDBKF_03070 51.7 Morganella morganii S1 yraN YraN family protein
EHELCC_07465 EHELCC_07465 51.7 Morganella morganii S2 yraN YraN family protein
NLDBIP_07790 NLDBIP_07790 51.7 Morganella morganii S4 yraN YraN family protein
LHKJJB_07325 LHKJJB_07325 51.7 Morganella morganii S3 yraN YraN family protein
HKOGLL_03605 HKOGLL_03605 51.7 Morganella morganii S5 yraN YraN family protein
F4V73_RS11850 F4V73_RS11850 52.5 Morganella psychrotolerans - YraN family protein

Distribution of the homologs in the orthogroup group_708

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_708

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N090 9.43e-41 134 50 1 126 3 plu4003 UPF0102 protein plu4003 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JR73 7.68e-33 114 51 0 110 3 YE3728 UPF0102 protein YE3728 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GJZ1 4.09e-31 110 48 0 110 3 Spro_4337 UPF0102 protein Spro_4337 Serratia proteamaculans (strain 568)
C6DIR6 9.24e-31 109 48 0 107 3 PC1_0307 UPF0102 protein PC1_0307 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7N0T3 2.08e-30 108 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli O81 (strain ED1a)
A8AQ33 2.63e-29 105 48 0 106 3 CKO_04542 UPF0102 protein CKO_04542 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XSZ5 4.17e-29 105 47 0 111 3 KPK_0567 UPF0102 protein KPK_0567 Klebsiella pneumoniae (strain 342)
Q9KUE1 4.47e-29 105 45 1 110 3 VC_0580 UPF0102 protein VC_0580 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LS70 4.47e-29 105 45 1 110 3 VCM66_0538 UPF0102 protein VCM66_0538 Vibrio cholerae serotype O1 (strain M66-2)
A5F986 4.47e-29 105 45 1 110 3 VC0395_A0112 UPF0102 protein VC0395_A0112/VC395_0597 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P45465 4.89e-29 105 46 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain K12)
B1IQX3 4.89e-29 105 46 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGW0 4.89e-29 105 46 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain K12 / DH10B)
C4ZSN9 4.89e-29 105 46 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain K12 / MC4100 / BW2952)
B5F6R8 6.29e-29 105 44 1 113 3 yraN UPF0102 protein YraN Salmonella agona (strain SL483)
A3Q9F0 6.34e-29 104 50 1 106 3 Shew_0226 UPF0102 protein Shew_0226 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A6VPC4 6.92e-29 104 45 1 117 3 Asuc_1462 UPF0102 protein Asuc_1462 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6TEG7 7.03e-29 104 46 0 111 3 KPN78578_35270 UPF0102 protein KPN78578_35270 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3YX93 7.49e-29 104 45 1 117 3 yraN UPF0102 protein YraN Shigella sonnei (strain Ss046)
B1LFP9 7.49e-29 104 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain SMS-3-5 / SECEC)
B7NKL7 7.49e-29 104 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0TCW1 8.53e-29 104 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJ44 8.53e-29 104 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1JL80 1.13e-28 103 47 0 110 3 YPK_0538 UPF0102 protein YPK_0538 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FDY9 1.13e-28 103 47 0 110 3 YpsIP31758_0474 UPF0102 protein YpsIP31758_0474 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1C1F7 1.13e-28 103 47 0 110 3 YPA_3753 UPF0102 protein YPA_3753 Yersinia pestis bv. Antiqua (strain Antiqua)
B2K3Y3 1.13e-28 103 47 0 110 3 YPTS_3679 UPF0102 protein YPTS_3679 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q8ZB75 1.13e-28 103 47 0 110 3 YPO3549 UPF0102 protein YPO3549/y0119/YP_3803 Yersinia pestis
Q665M2 1.13e-28 103 47 0 110 3 YPTB3494 UPF0102 protein YPTB3494 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THK3 1.13e-28 103 47 0 110 3 YPDSF_0348 UPF0102 protein YPDSF_0348 Yersinia pestis (strain Pestoides F)
Q1CE21 1.13e-28 103 47 0 110 3 YPN_3432 UPF0102 protein YPN_3432 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1Q7 1.13e-28 103 47 0 110 3 YpAngola_A1121 UPF0102 protein YpAngola_A1121 Yersinia pestis bv. Antiqua (strain Angola)
A9MPP3 1.17e-28 104 44 1 113 3 yraN UPF0102 protein YraN Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1R6J4 1.33e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain UTI89 / UPEC)
Q8FDA0 1.33e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AG53 1.33e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O1:K1 / APEC
B7MB69 1.33e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NDD2 1.45e-28 103 45 1 117 3 yraN UPF0102 protein YraN Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YS38 1.85e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAA3 1.85e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O157:H7
A7ZS44 2.18e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli O139:H28 (strain E24377A / ETEC)
A4WEW3 2.22e-28 103 45 0 107 3 Ent638_3585 UPF0102 protein Ent638_3585 Enterobacter sp. (strain 638)
Q32BI4 2.38e-28 103 44 1 117 3 yraN UPF0102 protein YraN Shigella dysenteriae serotype 1 (strain Sd197)
B6I1M3 2.38e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain SE11)
B7LH86 2.38e-28 103 44 1 117 3 yraN UPF0102 protein YraN Escherichia coli (strain 55989 / EAEC)
Q8ZLU3 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWB9 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella schwarzengrund (strain CVM19633)
B5BGH7 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella paratyphi A (strain AKU_12601)
C0PZ33 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella paratyphi C (strain RKS4594)
Q5PL93 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6Y0 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella newport (strain SL254)
B4TIY8 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella heidelberg (strain SL476)
B5REL5 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZT7 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella enteritidis PT4 (strain P125109)
B5FHZ3 4.01e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella dublin (strain CT_02021853)
Q7VMZ9 5.81e-28 102 46 2 110 3 HD_0802 UPF0102 protein HD_0802 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8Z3I8 8.68e-28 102 44 1 113 3 yraN UPF0102 protein YraN Salmonella typhi
B7M056 1.09e-27 101 43 1 117 3 yraN UPF0102 protein YraN Escherichia coli O8 (strain IAI1)
Q83JG9 1.1e-27 101 44 1 117 3 yraN UPF0102 protein YraN Shigella flexneri
Q0T0D3 1.1e-27 101 44 1 117 3 yraN UPF0102 protein YraN Shigella flexneri serotype 5b (strain 8401)
B7LMT7 1.23e-27 101 43 1 117 3 yraN UPF0102 protein YraN Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B0BQV2 2.51e-27 100 45 2 110 3 APJL_1381 UPF0102 protein APJL_1381 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYE2 2.59e-27 100 45 2 110 3 APP7_1414 UPF0102 protein APP7_1414 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N211 2.59e-27 100 45 2 110 3 APL_1363 UPF0102 protein APL_1363 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q31W27 6.09e-27 99 43 1 117 3 yraN UPF0102 protein YraN Shigella boydii serotype 4 (strain Sb227)
B2U2L9 6.09e-27 99 43 1 117 3 yraN UPF0102 protein YraN Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A4G1M4 1.02e-26 99 47 1 111 3 HEAR0176 UPF0102 protein HEAR0176 Herminiimonas arsenicoxydans
B0UTT1 1.07e-26 99 45 1 112 3 HSM_1206 UPF0102 protein HSM_1206 Histophilus somni (strain 2336)
Q0I2P6 1.55e-26 98 45 1 112 3 HS_0739 UPF0102 protein HS_0739 Histophilus somni (strain 129Pt)
Q0I040 2.54e-26 97 45 1 105 3 Shewmr7_0260 UPF0102 protein Shewmr7_0260 Shewanella sp. (strain MR-7)
Q0HDW9 2.74e-26 97 46 1 105 3 Shewmr4_3685 UPF0102 protein Shewmr4_3685 Shewanella sp. (strain MR-4)
Q8EK07 3.16e-26 97 45 1 105 3 SO_0299 UPF0102 protein SO_0299 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8G183 3.2e-26 97 45 2 106 3 Ssed_4252 UPF0102 protein Ssed_4252 Shewanella sediminis (strain HAW-EB3)
A9L682 9.29e-26 96 45 1 105 3 Sbal195_4188 UPF0102 protein Sbal195_4188 Shewanella baltica (strain OS195)
A3DA02 9.29e-26 96 45 1 105 3 Sbal_4100 UPF0102 protein Sbal_4100 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WTP9 9.29e-26 96 45 1 105 3 Shew185_4070 UPF0102 protein Shew185_4070 Shewanella baltica (strain OS185)
B8EBD9 9.29e-26 96 45 1 105 3 Sbal223_3990 UPF0102 protein Sbal223_3990 Shewanella baltica (strain OS223)
P57862 1.3e-25 96 42 1 111 3 PM0647 UPF0102 protein PM0647 Pasteurella multocida (strain Pm70)
A5UBM3 2.56e-25 95 42 1 111 3 CGSHiEE_03775 UPF0102 protein CGSHiEE_03775 Haemophilus influenzae (strain PittEE)
A5UF93 2.56e-25 95 42 1 111 3 CGSHiGG_01960 UPF0102 protein CGSHiGG_01960 Haemophilus influenzae (strain PittGG)
Q4QJT7 2.56e-25 95 42 1 111 3 NTHI1958 UPF0102 protein NTHI1958 Haemophilus influenzae (strain 86-028NP)
B1KP82 2.85e-25 95 44 2 106 3 Swoo_0351 UPF0102 protein Swoo_0351 Shewanella woodyi (strain ATCC 51908 / MS32)
A0L230 3.22e-25 94 44 1 105 3 Shewana3_3881 UPF0102 protein Shewana3_3881 Shewanella sp. (strain ANA-3)
A1RPP5 4.61e-25 94 42 1 108 3 Sputw3181_3835 UPF0102 protein Sputw3181_3835 Shewanella sp. (strain W3-18-1)
A4YBR8 4.61e-25 94 42 1 108 3 Sputcn32_3693 UPF0102 protein Sputcn32_3693 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P45300 6.82e-25 94 42 1 111 3 HI_1656 UPF0102 protein HI_1656 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65T14 8.96e-25 94 40 1 111 3 MS1289 UPF0102 protein MS1289 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q088R4 2.05e-24 92 46 2 105 3 Sfri_0388 UPF0102 protein Sfri_0388 Shewanella frigidimarina (strain NCIMB 400)
Q2KU88 3.53e-23 90 37 1 124 3 BAV3162 UPF0102 protein BAV3162 Bordetella avium (strain 197N)
A1SB01 6.91e-23 89 42 1 106 3 Sama_3355 UPF0102 protein Sama_3355 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12SK8 9.68e-23 88 42 1 107 3 Sden_0272 UPF0102 protein Sden_0272 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6SUE7 1e-22 89 46 1 111 3 mma_0204 UPF0102 protein mma_0204 Janthinobacterium sp. (strain Marseille)
Q83AY5 1.76e-22 88 40 2 114 3 CBU_1742 UPF0102 protein CBU_1742 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q3K732 1.86e-22 88 41 3 120 3 Pfl01_4685 UPF0102 protein Pfl01_4685 Pseudomonas fluorescens (strain Pf0-1)
Q0K5T4 3.23e-22 87 43 2 116 3 H16_A3579 UPF0102 protein H16_A3579 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A9KBY7 4.83e-22 87 40 2 111 3 CBUD_0259 UPF0102 protein CBUD_0259 Coxiella burnetii (strain Dugway 5J108-111)
A9NAA4 4.83e-22 87 40 2 111 3 COXBURSA331_A1934 UPF0102 protein COXBURSA331_A1934 Coxiella burnetii (strain RSA 331 / Henzerling II)
Q87SH5 6.24e-22 86 39 2 111 3 VP0448 UPF0102 protein VP0448 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWM0 7.14e-22 86 38 1 113 3 VIBHAR_00890 UPF0102 protein VIBHAR_00890 Vibrio campbellii (strain ATCC BAA-1116)
Q88N88 1.01e-21 86 41 2 124 3 PP_1324 UPF0102 protein PP_1324 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B5FB46 2.03e-21 85 38 1 110 3 VFMJ11_2324 UPF0102 protein VFMJ11_2324 Aliivibrio fischeri (strain MJ11)
Q5E2N9 2.03e-21 85 38 1 110 3 VF_2212 UPF0102 protein VF_2212 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q47VU1 2.16e-21 85 40 1 110 3 CPS_4433 UPF0102 protein CPS_4433 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3JE65 2.21e-21 85 38 2 117 3 Noc_0355 UPF0102 protein Noc_0355 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B0TL64 2.71e-21 85 37 2 106 3 Shal_4069 UPF0102 protein Shal_4069 Shewanella halifaxensis (strain HAW-EB4)
B6J4R1 3.34e-21 85 39 2 111 3 CbuK_0265 UPF0102 protein CbuK_0265 Coxiella burnetii (strain CbuK_Q154)
B0KFT8 5.52e-21 84 42 2 119 3 PputGB1_4524 UPF0102 protein PputGB1_4524 Pseudomonas putida (strain GB-1)
A5W8R2 5.52e-21 84 40 2 123 3 Pput_4400 UPF0102 protein Pput_4400 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I5A6 7.48e-21 84 42 2 119 3 PSEEN4497 UPF0102 protein PSEEN4497 Pseudomonas entomophila (strain L48)
A8GZ42 1.11e-20 83 36 2 106 3 Spea_0251 UPF0102 protein Spea_0251 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0U003 2.59e-20 82 36 2 111 3 Fphi_0415 UPF0102 protein Fphi_0415 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2UG56 2.71e-20 82 42 4 114 3 Rpic_3463 UPF0102 protein Rpic_3463 Ralstonia pickettii (strain 12J)
B6ELI6 2.87e-20 82 41 2 110 3 VSAL_I2655 UPF0102 protein VSAL_I2655 Aliivibrio salmonicida (strain LFI1238)
Q2STV7 4.8e-20 82 38 2 118 3 BTH_I3148 UPF0102 protein BTH_I3148 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q146Q2 7.06e-20 82 36 2 121 3 Bxeno_A0149 UPF0102 protein Bxeno_A0149 Paraburkholderia xenovorans (strain LB400)
Q47IS1 8.38e-20 81 39 1 111 3 Daro_0503 UPF0102 protein Daro_0503 Dechloromonas aromatica (strain RCB)
B1J1X8 8.49e-20 81 39 2 119 3 PputW619_0932 UPF0102 protein PputW619_0932 Pseudomonas putida (strain W619)
Q6LME3 1.24e-19 81 38 1 118 3 PBPRA3228 UPF0102 protein PBPRA3228 Photobacterium profundum (strain SS9)
A0KPY4 1.62e-19 80 38 0 108 3 AHA_3896 UPF0102 protein AHA_3896 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3P0J9 2.4e-19 80 39 2 110 3 BURPS1106A_3900 UPF0102 protein BURPS1106A_3900 Burkholderia pseudomallei (strain 1106a)
A3MR08 3.14e-19 80 38 2 114 3 BMA10247_3176 UPF0102 protein BMA10247_3176 Burkholderia mallei (strain NCTC 10247)
A2S703 3.14e-19 80 38 2 114 3 BMA10229_A1742 UPF0102 protein BMA10229_A1742 Burkholderia mallei (strain NCTC 10229)
Q62G58 3.14e-19 80 38 2 114 3 BMA2801 UPF0102 protein BMA2801 Burkholderia mallei (strain ATCC 23344)
A1UZH3 3.14e-19 80 38 2 114 3 BMASAVP1_A0024 UPF0102 protein BMASAVP1_A0024 Burkholderia mallei (strain SAVP1)
B3R808 4.17e-19 79 42 2 107 3 RALTA_A3032 UPF0102 protein RALTA_A3032 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8XUC6 4.58e-19 79 47 4 104 3 RSc3265 UPF0102 protein RSc3265 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A3NEP2 5.51e-19 80 38 2 108 3 BURPS668_3819 UPF0102 protein BURPS668_3819 Burkholderia pseudomallei (strain 668)
A1WYV5 5.79e-19 79 38 2 122 3 Hhal_2103 UPF0102 protein Hhal_2103 Halorhodospira halophila (strain DSM 244 / SL1)
Q63PU8 6.13e-19 79 37 2 114 3 BPSL3274 UPF0102 protein BPSL3274 Burkholderia pseudomallei (strain K96243)
Q3JY95 6.13e-19 79 37 2 114 3 BURPS1710b_0041 UPF0102 protein BURPS1710b_0041 Burkholderia pseudomallei (strain 1710b)
Q39KM3 6.23e-19 79 40 2 110 3 Bcep18194_A3391 UPF0102 protein Bcep18194_A3391 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5ZR89 6.59e-19 79 37 3 112 3 lpg2994 UPF0102 protein lpg2994 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IIJ5 1.02e-18 78 36 3 112 3 LPC_3309 UPF0102 protein LPC_3309 Legionella pneumophila (strain Corby)
Q5X0N1 1.02e-18 78 36 3 112 3 lpp3065 UPF0102 protein lpp3065 Legionella pneumophila (strain Paris)
Q4K6I1 1.32e-18 78 36 2 123 3 PFL_5073 UPF0102 protein PFL_5073 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21RN1 2.54e-18 77 36 4 129 3 Rfer_3873 UPF0102 protein Rfer_3873 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7P0B3 2.78e-18 77 40 3 110 3 CV_0654 UPF0102 protein CV_0654 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0BJB0 3.08e-18 77 39 3 111 3 Bamb_0202 UPF0102 protein Bamb_0202 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q82WG1 4.48e-18 77 39 2 114 3 NE0719 UPF0102 protein NE0719 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A0K3G7 9.97e-18 76 38 3 111 3 Bcen2424_0290 UPF0102 protein Bcen2424_0290 Burkholderia cenocepacia (strain HI2424)
Q1BRP1 9.97e-18 76 38 3 111 3 Bcen_2816 UPF0102 protein Bcen_2816 Burkholderia orbicola (strain AU 1054)
A5EVA6 1.07e-17 76 40 3 112 3 DNO_0639 UPF0102 protein DNO_0639 Dichelobacter nodosus (strain VCS1703A)
A4JAG1 1.11e-17 76 38 2 113 3 Bcep1808_0248 UPF0102 protein Bcep1808_0248 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2S9Y0 1.21e-17 75 39 1 94 3 HCH_05895 UPF0102 protein HCH_05895 Hahella chejuensis (strain KCTC 2396)
B2SNY1 1.68e-17 75 34 2 116 3 PXO_04380 UPF0102 protein PXO_04380 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5GW28 1.68e-17 75 34 2 116 3 XOO3839 UPF0102 protein XOO3839 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZA5 1.68e-17 75 34 2 116 3 XOO3617 UPF0102 protein XOO3617 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A6VXY8 2.47e-17 75 37 4 119 3 Mmwyl1_2395 UPF0102 protein Mmwyl1_2395 Marinomonas sp. (strain MWYL1)
Q1LHS4 3e-17 75 43 2 116 3 Rmet_3430 UPF0102 protein Rmet_3430 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3A2F1 3.16e-17 74 38 1 100 3 Pcar_2217 UPF0102 protein Pcar_2217 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1SU47 4.36e-17 74 37 2 108 3 Ping_1176 UPF0102 protein Ping_1176 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5NGE7 5.1e-17 74 34 2 111 3 FTT_0898c UPF0102 protein FTT_0898c Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HU9 5.1e-17 74 34 2 111 3 FTF0898c UPF0102 protein FTF0898c Francisella tularensis subsp. tularensis (strain FSC 198)
Q0VS15 5.59e-17 74 37 3 121 3 ABO_0585 UPF0102 protein ABO_0585 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q67PD3 8.23e-17 73 41 1 94 3 STH1475 UPF0102 protein STH1475 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2SF73 8.57e-17 73 33 2 111 3 FTM_0486 UPF0102 protein FTM_0486 Francisella tularensis subsp. mediasiatica (strain FSC147)
A4IYQ8 8.57e-17 73 33 2 111 3 FTW_1281 UPF0102 protein FTW_1281 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q87WX3 8.59e-17 73 39 4 128 3 PSPTO_4420 UPF0102 protein PSPTO_4420 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A5WCR1 9.07e-17 74 39 5 114 3 PsycPRwf_0497 UPF0102 protein PsycPRwf_0497 Psychrobacter sp. (strain PRwf-1)
Q2YCL8 1.12e-16 73 41 3 115 3 Nmul_A0195 UPF0102 protein Nmul_A0195 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7MNW2 1.34e-16 73 35 1 111 3 VV0603 UPF0102 protein VV0603 Vibrio vulnificus (strain YJ016)
Q8DEJ8 1.34e-16 73 35 1 111 3 VV1_0590 UPF0102 protein VV1_0590 Vibrio vulnificus (strain CMCP6)
A2SMD0 1.68e-16 72 35 3 123 3 Mpe_A3766 UPF0102 protein Mpe_A3766 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A0Q512 1.99e-16 72 33 2 111 3 FTN_0424 UPF0102 protein FTN_0424 Francisella tularensis subsp. novicida (strain U112)
Q4ZNX8 2.9e-16 72 38 2 115 3 Psyr_4114 UPF0102 protein Psyr_4114 Pseudomonas syringae pv. syringae (strain B728a)
B9M598 3.23e-16 72 38 1 99 3 Geob_1494 UPF0102 protein Geob_1494 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q48EE6 3.71e-16 72 37 3 123 3 PSPPH_4120 UPF0102 protein PSPPH_4120 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q15PJ2 4.29e-16 71 35 1 110 3 Patl_3694 UPF0102 protein Patl_3694 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8PPC2 4.69e-16 71 37 2 97 3 XAC0764 UPF0102 protein XAC0764 Xanthomonas axonopodis pv. citri (strain 306)
C0QTY9 7.26e-16 71 34 1 113 3 PERMA_0362 UPF0102 protein PERMA_0362 Persephonella marina (strain DSM 14350 / EX-H1)
Q82WG7 9.88e-16 70 40 2 114 3 NE0711 UPF0102 protein NE0711 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3BXG6 1.23e-15 70 37 2 97 3 XCV0816 UPF0102 protein XCV0816 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q1GYY7 1.39e-15 70 43 2 100 3 Mfla_2283 UPF0102 protein Mfla_2283 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q21FX6 1.73e-15 70 42 1 107 3 Sde_3146 UPF0102 protein Sde_3146 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1K3T3 1.83e-15 70 34 1 112 3 azo0871 UPF0102 protein azo0871 Azoarcus sp. (strain BH72)
Q1QVF6 1.85e-15 70 41 1 95 3 Csal_2201 UPF0102 protein Csal_2201 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3IG11 2.48e-15 70 36 1 109 3 PSHAa2523 UPF0102 protein PSHAa2523 Pseudoalteromonas translucida (strain TAC 125)
Q4FQF2 3.07e-15 70 41 3 102 3 Psyc_1908 UPF0102 protein Psyc_1908 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q60CC4 4.25e-15 69 36 2 115 3 MCA0184 UPF0102 protein MCA0184 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WFK6 4.45e-15 69 35 4 114 3 Veis_0630 UPF0102 protein Veis_0630 Verminephrobacter eiseniae (strain EF01-2)
A4VIG6 4.9e-15 69 37 2 113 3 PST_1070 UPF0102 protein PST_1070 Stutzerimonas stutzeri (strain A1501)
Q31EY6 5.12e-15 68 38 3 110 3 Tcr_1695 UPF0102 protein Tcr_1695 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4SC34 5.9e-15 69 35 1 99 3 Cvib_0014 UPF0102 protein Cvib_0014 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A5G7Z1 6.32e-15 68 38 1 100 3 Gura_3756 UPF0102 protein Gura_3756 Geotalea uraniireducens (strain Rf4)
B8FRJ6 7.09e-15 68 37 2 115 3 Dhaf_3740 UPF0102 protein Dhaf_3740 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A1U3H0 9.74e-15 68 46 0 78 3 Maqu_2464 UPF0102 protein Maqu_2464 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3AP35 1.6e-14 68 37 1 103 3 Cag_1992 UPF0102 protein Cag_1992 Chlorobium chlorochromatii (strain CaD3)
Q24UC6 1.81e-14 67 36 2 115 3 DSY2577 UPF0102 protein DSY2577 Desulfitobacterium hafniense (strain Y51)
A4XQR2 1.9e-14 67 38 2 113 3 Pmen_0910 UPF0102 protein Pmen_0910 Pseudomonas mendocina (strain ymp)
Q1Q8M8 2.61e-14 68 40 3 102 3 Pcryo_2198 UPF0102 protein Pcryo_2198 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9KLL5 2.83e-14 67 33 1 109 3 Cphy_2398 UPF0102 protein Cphy_2398 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8R616 3.48e-14 67 30 1 113 3 FN1370 UPF0102 protein FN1370 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0A6J0 3.88e-14 67 43 1 113 3 Mlg_2205 UPF0102 protein Mlg_2205 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q46W60 4.06e-14 67 38 2 116 3 Reut_A3265 UPF0102 protein Reut_A3265 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3ZXD5 4.19e-14 66 32 2 113 3 cbdbA757 UPF0102 protein cbdbA757 Dehalococcoides mccartyi (strain CBDB1)
A5FR87 4.19e-14 66 32 2 113 3 DehaBAV1_0707 UPF0102 protein DehaBAV1_0707 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B5YIA9 5.04e-14 66 30 1 107 3 THEYE_A1950 UPF0102 protein THEYE_A1950 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A8M6A9 5.89e-14 66 41 1 94 3 Sare_1228 UPF0102 protein Sare_1228 Salinispora arenicola (strain CNS-205)
Q8PCL4 6.67e-14 66 41 1 82 3 XCC0710 UPF0102 protein XCC0710 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVB9 6.67e-14 66 41 1 82 3 xcc-b100_3645 UPF0102 protein xcc-b100_3645 Xanthomonas campestris pv. campestris (strain B100)
Q4UQV6 6.67e-14 66 41 1 82 3 XC_3524 UPF0102 protein XC_3524 Xanthomonas campestris pv. campestris (strain 8004)
Q18BD4 7.15e-14 65 34 1 93 3 CD630_12710 UPF0102 protein CD630_12710 Clostridioides difficile (strain 630)
A4XLE5 7.69e-14 65 37 3 96 3 Csac_2148 UPF0102 protein Csac_2148 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B2V8B3 8.07e-14 65 31 1 106 3 SYO3AOP1_0546 UPF0102 protein SYO3AOP1_0546 Sulfurihydrogenibium sp. (strain YO3AOP1)
B0U468 9.39e-14 65 37 2 108 3 Xfasm12_1748 UPF0102 protein Xfasm12_1748 Xylella fastidiosa (strain M12)
B2I7R6 9.39e-14 65 37 2 108 3 XfasM23_1674 UPF0102 protein XfasM23_1674 Xylella fastidiosa (strain M23)
Q87B72 9.39e-14 65 37 2 108 3 PD_1586 UPF0102 protein PD_1586 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q0AFH8 9.5e-14 65 42 2 116 3 Neut_1662 UPF0102 protein Neut_1662 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9PFV3 1.14e-13 65 37 2 108 3 XF_0554 UPF0102 protein XF_0554 Xylella fastidiosa (strain 9a5c)
Q8FP66 1.49e-13 65 40 6 110 3 CE1920 UPF0102 protein CE1920 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1W341 1.63e-13 65 37 3 119 3 Ajs_0414 UPF0102 protein Ajs_0414 Acidovorax sp. (strain JS42)
Q5YS49 2.93e-13 64 36 1 96 3 NFA_41430 UPF0102 protein NFA_41430 Nocardia farcinica (strain IFM 10152)
Q9JWJ8 3.13e-13 64 36 2 108 3 NMA0341 UPF0102 protein NMA0341 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KWG5 3.13e-13 64 36 2 108 3 NMC2069 UPF0102 protein NMC2069 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q02H16 3.7e-13 64 34 2 125 3 PA14_57490 UPF0102 protein PA14_57490 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZK2 3.7e-13 64 34 2 125 3 PLES_48031 UPF0102 protein PLES_48031 Pseudomonas aeruginosa (strain LESB58)
Q9HVZ1 3.7e-13 64 34 2 125 3 PA4424 UPF0102 protein PA4424 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3Z8D6 3.76e-13 64 30 2 113 3 DET0781 UPF0102 protein DET0781 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
C1B2T3 4.26e-13 63 38 1 97 3 ROP_66030 UPF0102 protein ROP_66030 Rhodococcus opacus (strain B4)
B5YFD1 7.05e-13 63 30 1 96 3 DICTH_1420 UPF0102 protein DICTH_1420 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B4RQP8 7.56e-13 63 36 2 108 3 NGK_2254 UPF0102 protein NGK_2254 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5E2 7.56e-13 63 36 2 108 3 NGO1987 UPF0102 protein NGO1987 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5N821 1.03e-12 63 36 1 94 3 CKL_1410 UPF0102 protein CKL_1410 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
C0QVG4 1.17e-12 63 31 3 116 3 BHWA1_02005 UPF0102 protein BHWA1_02005 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A1VIW8 1.32e-12 63 41 5 108 3 Pnap_0271 UPF0102 protein Pnap_0271 Polaromonas naphthalenivorans (strain CJ2)
Q39RP2 1.39e-12 62 37 2 99 3 Gmet_2864 UPF0102 protein Gmet_2864 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9JXE2 1.47e-12 62 35 2 108 3 NMB2089 UPF0102 protein NMB2089 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M478 1.54e-12 62 35 2 108 3 NMCC_2054 UPF0102 protein NMCC_2054 Neisseria meningitidis serogroup C (strain 053442)
A1R7F9 1.88e-12 62 31 0 91 3 AAur_2443 UPF0102 protein AAur_2443 Paenarthrobacter aurescens (strain TC1)
Q5SLC1 2e-12 62 39 0 81 3 TTHA0372 UPF0102 protein TTHA0372 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A1AN88 2.15e-12 62 35 2 98 3 Ppro_1186 UPF0102 protein Ppro_1186 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B3EJJ5 2.34e-12 62 33 1 96 3 Cphamn1_0017 UPF0102 protein Cphamn1_0017 Chlorobium phaeobacteroides (strain BS1)
B0VA98 2.73e-12 62 36 1 103 3 ABAYE2669 UPF0102 protein ABAYE2669 Acinetobacter baumannii (strain AYE)
B7GX68 2.73e-12 62 36 1 103 3 ABBFA_002499 UPF0102 protein ABBFA_002499 Acinetobacter baumannii (strain AB307-0294)
B0VKV0 2.73e-12 62 36 1 103 3 ABSDF1354 UPF0102 protein ABSDF1354 Acinetobacter baumannii (strain SDF)
B7I8W9 2.73e-12 62 36 1 103 3 AB57_1130 UPF0102 protein AB57_1130 Acinetobacter baumannii (strain AB0057)
B2HWE2 2.73e-12 62 36 1 103 3 ACICU_01089 UPF0102 protein ACICU_01089 Acinetobacter baumannii (strain ACICU)
A3M3I7 2.73e-12 62 36 1 103 3 A1S_1049 UPF0102 protein A1S_1049 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q74FF9 2.87e-12 62 35 1 98 3 GSU0650 UPF0102 protein GSU0650 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1T766 3.47e-12 62 38 0 89 3 Mvan_2202 UPF0102 protein Mvan_2202 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0S2B2 3.57e-12 61 36 1 97 3 RHA1_ro06551 UPF0102 protein RHA1_ro06551 Rhodococcus jostii (strain RHA1)
Q3SWF7 5.54e-12 61 34 2 106 3 Nwi_0116 UPF0102 protein Nwi_0116 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q6A7T5 5.75e-12 61 35 0 87 3 PPA1431 UPF0102 protein PPA1431 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8E2G0 6.3e-12 61 32 1 96 3 Dtur_1530 UPF0102 protein Dtur_1530 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q72LQ3 7.26e-12 60 38 0 81 3 TT_C0005 UPF0102 protein TT_C0005 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A8MHC8 8.05e-12 60 32 1 113 3 Clos_1471 UPF0102 protein Clos_1471 Alkaliphilus oremlandii (strain OhILAs)
A6VB97 8.28e-12 60 34 2 115 3 PSPA7_4996 UPF0102 protein PSPA7_4996 Pseudomonas aeruginosa (strain PA7)
A6W7V6 1.4e-11 60 33 1 106 3 Krad_1407 UPF0102 protein Krad_1407 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B3E4L0 1.41e-11 60 33 2 105 3 Glov_2230 UPF0102 protein Glov_2230 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A8ZV12 1.55e-11 60 35 1 94 3 Dole_2298 UPF0102 protein Dole_2298 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q12GI7 1.81e-11 60 32 4 124 3 Bpro_0391 UPF0102 protein Bpro_0391 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q6FD45 1.84e-11 60 34 1 101 3 ACIAD1132 UPF0102 protein ACIAD1132 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1IX45 2.29e-11 59 37 1 82 3 Dgeo_1894 UPF0102 protein Dgeo_1894 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A1TJU6 3.68e-11 59 37 3 118 3 Aave_0630 UPF0102 protein Aave_0630 Paracidovorax citrulli (strain AAC00-1)
A4FME3 4.33e-11 59 31 1 98 3 SACE_6045 UPF0102 protein SACE_6045 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q11XW1 5.12e-11 58 36 2 101 3 CHU_0465 UPF0102 protein CHU_0465 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q2J329 6.3e-11 58 31 3 115 3 RPB_0420 UPF0102 protein RPB_0420 Rhodopseudomonas palustris (strain HaA2)
C5BWW3 6.43e-11 58 44 0 63 3 Bcav_2532 UPF0102 protein Bcav_2532 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q6AJE4 7.09e-11 58 32 1 95 3 DP2807 UPF0102 protein DP2807 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A5D1I2 8.59e-11 58 32 2 108 3 PTH_1707 UPF0102 protein PTH_1707 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A9I0M2 9.39e-11 58 36 1 112 3 Bpet0439 UPF0102 protein Bpet0439 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1BCI0 9.66e-11 58 31 1 109 3 Cpha266_0037 UPF0102 protein Cpha266_0037 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q3AC88 1.18e-10 57 29 2 114 3 CHY_1414 UPF0102 protein CHY_1414 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8R5S3 1.2e-10 57 34 1 94 3 TTE1452 UPF0102 protein TTE1452 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A5UU10 1.36e-10 57 36 1 97 3 RoseRS_1723 UPF0102 protein RoseRS_1723 Roseiflexus sp. (strain RS-1)
A3PXX6 1.47e-10 57 33 3 110 3 Mjls_1965 UPF0102 protein Mjls_1965 Mycobacterium sp. (strain JLS)
B3EDP4 1.97e-10 57 34 1 100 3 Clim_0016 UPF0102 protein Clim_0016 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q0AWX4 2e-10 57 34 1 96 3 Swol_1475 UPF0102 protein Swol_1475 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A5FKL6 2.06e-10 57 32 1 97 3 Fjoh_1217 UPF0102 protein Fjoh_1217 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q8XJQ1 2.34e-10 57 34 1 94 3 CPE1705 UPF0102 protein CPE1705 Clostridium perfringens (strain 13 / Type A)
A4QF37 2.39e-10 57 38 5 99 3 cgR_1859 UPF0102 protein cgR_1859 Corynebacterium glutamicum (strain R)
Q8NNZ6 2.55e-10 57 38 5 99 3 Cgl2031 UPF0102 protein Cgl2031/cg2228 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6TRS2 2.78e-10 56 34 1 95 3 Amet_2739 UPF0102 protein Amet_2739 Alkaliphilus metalliredigens (strain QYMF)
Q5R0L0 3.79e-10 56 28 1 110 3 IL0423 UPF0102 protein IL0423 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B9MQX5 3.87e-10 56 34 0 79 3 Athe_0977 UPF0102 protein Athe_0977 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A1UEH2 4.34e-10 56 35 2 96 3 Mkms_2031 UPF0102 protein Mkms_2031 Mycobacterium sp. (strain KMS)
Q1BAJ0 4.34e-10 56 35 2 96 3 Mmcs_1985 UPF0102 protein Mmcs_1985 Mycobacterium sp. (strain MCS)
A0LV62 5.34e-10 56 32 2 109 3 Acel_1550 UPF0102 protein Acel_1550 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q1MRU7 5.51e-10 56 32 2 115 3 LI0223 UPF0102 protein LI0223 Lawsonia intracellularis (strain PHE/MN1-00)
Q2LVT7 6.23e-10 56 33 1 96 3 SYNAS_23220 UPF0102 protein SYNAS_23220 Syntrophus aciditrophicus (strain SB)
Q97I89 6.88e-10 55 32 1 94 3 CA_C1763 UPF0102 protein CA_C1763 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6NCZ4 7.52e-10 55 32 2 97 1 RPA0323 UPF0102 protein RPA0323 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2S1J6 1.05e-09 55 31 2 102 3 SRU_1822 UPF0102 protein SRU_1822 Salinibacter ruber (strain DSM 13855 / M31)
A9WP53 1.15e-09 55 31 1 96 3 RSal33209_1090 UPF0102 protein RSal33209_1090 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A4TEA7 1.18e-09 55 34 2 99 3 Mflv_4140 UPF0102 protein Mflv_4140 Mycolicibacterium gilvum (strain PYR-GCK)
Q07UR7 1.32e-09 55 30 2 106 3 RPE_0358 UPF0102 protein RPE_0358 Rhodopseudomonas palustris (strain BisA53)
B3QQX9 1.53e-09 55 33 2 107 3 Cpar_0015 UPF0102 protein Cpar_0015 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B1VYV2 1.85e-09 54 32 1 97 3 SGR_1878 UPF0102 protein SGR_1878 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q7U7D4 1.94e-09 55 37 1 87 3 SYNW1051 UPF0102 protein SYNW1051 Parasynechococcus marenigrum (strain WH8102)
Q0C451 2.17e-09 54 33 2 101 3 HNE_0764 UPF0102 protein HNE_0764 Hyphomonas neptunium (strain ATCC 15444)
A6LSN5 2.19e-09 54 30 1 94 3 Cbei_1183 UPF0102 protein Cbei_1183 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7NKS5 2.29e-09 54 34 1 97 3 Rcas_2007 UPF0102 protein Rcas_2007 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A0PQ75 2.34e-09 54 35 2 99 3 MUL_2060 UPF0102 protein MUL_2060 Mycobacterium ulcerans (strain Agy99)
B2HJM5 2.34e-09 54 35 2 99 3 MMAR_1812 UPF0102 protein MMAR_1812 Mycobacterium marinum (strain ATCC BAA-535 / M)
B2S4F0 2.38e-09 54 33 1 101 3 TPASS_0913 UPF0102 protein TPASS_0913 Treponema pallidum subsp. pallidum (strain SS14)
O83883 2.38e-09 54 33 1 101 3 TP_0913 UPF0102 protein TP_0913 Treponema pallidum (strain Nichols)
A7GG28 2.46e-09 54 28 0 81 3 CLI_2496 UPF0102 protein CLI_2496 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I4L8 2.46e-09 54 28 0 81 3 CBO2440 UPF0102 protein CBO2440/CLC_2288 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FW04 2.46e-09 54 28 0 81 3 CLB_2304 UPF0102 protein CLB_2304 Clostridium botulinum (strain ATCC 19397 / Type A)
B1II71 2.46e-09 54 28 0 81 3 CLD_2200 UPF0102 protein CLD_2200 Clostridium botulinum (strain Okra / Type B1)
A5U6Q3 2.5e-09 54 37 1 85 3 MRA_2923 UPF0102 protein MRA_2923 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P67231 2.5e-09 54 37 1 85 3 BQ2027_MB2922C UPF0102 protein Mb2922c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1KMP2 2.5e-09 54 37 1 85 3 BCG_2919c UPF0102 protein BCG_2919c Mycobacterium bovis (strain BCG / Pasteur 1173P2)
C1AG13 2.5e-09 54 37 1 85 3 JTY_2914 UPF0102 protein JTY_2914 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
P9WFM9 2.5e-09 54 37 1 85 3 Rv2898c UPF0102 protein Rv2898c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFM8 2.5e-09 54 37 1 85 3 MT2966 UPF0102 protein MT2966 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B7GSU4 2.62e-09 54 31 2 106 3 Blon_1698 UPF0102 protein Blon_1698/BLIJ_1758 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q55761 2.71e-09 55 37 3 97 3 sll0189 UPF0102 protein sll0189 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0TPP8 3.12e-09 54 32 1 94 3 CPF_1959 UPF0102 protein CPF_1959 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q89WK9 3.41e-09 54 32 2 106 3 bll0669 UPF0102 protein bll0669 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9RS45 3.73e-09 53 35 2 88 3 DR_2282 UPF0102 protein DR_2282 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q21CJ1 4.28e-09 54 31 3 115 3 RPC_0320 UPF0102 protein RPC_0320 Rhodopseudomonas palustris (strain BisB18)
A0JXT3 4.59e-09 53 29 1 102 3 Arth_2474 UPF0102 protein Arth_2474 Arthrobacter sp. (strain FB24)
Q8KAA4 4.92e-09 53 33 1 96 3 CT2262 UPF0102 protein CT2262 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q025A4 4.95e-09 53 38 2 97 3 Acid_2433 UPF0102 protein Acid_2433 Solibacter usitatus (strain Ellin6076)
C0RGN1 5.05e-09 53 35 3 111 3 BMEA_A0185 UPF0102 protein BMEA_A0185 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M7C3 5.05e-09 53 35 3 111 3 BCAN_A0183 UPF0102 protein BCAN_A0183 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B0CJ37 5.05e-09 53 35 3 111 3 BSUIS_A0179 UPF0102 protein BSUIS_A0179 Brucella suis (strain ATCC 23445 / NCTC 10510)
P67229 5.05e-09 53 35 3 111 3 BR0178 UPF0102 protein BR0178/BS1330_I0178 Brucella suis biovar 1 (strain 1330)
Q2YP29 5.05e-09 53 35 3 111 3 BAB1_0178 UPF0102 protein BAB1_0178 Brucella abortus (strain 2308)
P67228 5.05e-09 53 35 3 111 3 BMEI1769 UPF0102 protein BMEI1769 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57FJ9 5.05e-09 53 35 3 111 3 BruAb1_0174 UPF0102 protein BruAb1_0174 Brucella abortus biovar 1 (strain 9-941)
B2S8H0 5.05e-09 53 35 3 111 3 BAbS19_I01690 UPF0102 protein BAbS19_I01690 Brucella abortus (strain S19)
Q8G5R9 5.12e-09 53 31 2 106 3 BL0935 UPF0102 protein BL0935 Bifidobacterium longum (strain NCC 2705)
C1FSL0 5.29e-09 53 27 0 81 3 CLM_2733 UPF0102 protein CLM_2733 Clostridium botulinum (strain Kyoto / Type A2)
Q2JJU2 5.49e-09 53 33 3 106 3 CYB_2119 UPF0102 protein CYB_2119 Synechococcus sp. (strain JA-2-3B'a(2-13))
B3QZF2 5.59e-09 53 32 1 95 3 Ctha_1382 UPF0102 protein Ctha_1382 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q2JWH1 6.03e-09 53 33 3 106 3 CYA_0680 UPF0102 protein CYA_0680 Synechococcus sp. (strain JA-3-3Ab)
B1KWN0 7.36e-09 53 27 0 81 3 CLK_1817 UPF0102 protein CLK_1817 Clostridium botulinum (strain Loch Maree / Type A3)
Q313K2 8.25e-09 54 34 1 94 3 Dde_1093 UPF0102 protein Dde_1093 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A6WVB4 8.51e-09 53 33 3 113 3 Oant_0187 UPF0102 protein Oant_0187 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1SLR5 1.01e-08 52 32 1 97 3 Noca_3248 UPF0102 protein Noca_3248 Nocardioides sp. (strain ATCC BAA-499 / JS614)
A4X4J0 1.05e-08 52 42 0 66 3 Strop_1320 UPF0102 protein Strop_1320 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B0REN8 1.05e-08 52 30 3 117 3 CMS0765 UPF0102 protein CMS0765 Clavibacter sepedonicus
Q11B48 1.05e-08 52 31 3 112 3 Meso_4010 UPF0102 protein Meso_4010 Chelativorans sp. (strain BNC1)
A0M5Z7 1.11e-08 52 31 1 96 3 GFO_3098 UPF0102 protein GFO_3098 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q1QRV0 1.24e-08 52 31 2 106 3 Nham_0146 UPF0102 protein Nham_0146 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B2TJ35 1.31e-08 52 29 1 94 3 CLL_A1253 UPF0102 protein CLL_A1253 Clostridium botulinum (strain Eklund 17B / Type B)
Q47S60 1.43e-08 52 38 0 70 3 Tfu_0669 UPF0102 protein Tfu_0669 Thermobifida fusca (strain YX)
C5CGT1 1.81e-08 52 32 3 94 3 Kole_1919 UPF0102 protein Kole_1919 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A7HZ51 1.97e-08 52 28 2 114 3 Plav_3586 UPF0102 protein Plav_3586 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A8HYK3 2.07e-08 52 29 2 98 3 AZC_4471 UPF0102 protein AZC_4471 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8HA88 2.17e-08 52 32 0 87 3 Achl_2213 UPF0102 protein Achl_2213 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A1UTL4 2.17e-08 52 33 2 101 3 BARBAKC583_1042 UPF0102 protein BARBAKC583_1042 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A1A0Z4 2.64e-08 52 32 1 94 3 BAD_0596 UPF0102 protein BAD_0596 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B2V4E9 2.71e-08 51 30 1 94 3 CLH_1204 UPF0102 protein CLH_1204 Clostridium botulinum (strain Alaska E43 / Type E3)
Q0SSB5 2.74e-08 51 32 1 94 3 CPR_1677 UPF0102 protein CPR_1677 Clostridium perfringens (strain SM101 / Type A)
Q4JV13 2.78e-08 52 30 2 97 3 jk1180 UPF0102 protein jk1180 Corynebacterium jeikeium (strain K411)
Q13E51 2.9e-08 52 28 3 115 3 RPD_0400 UPF0102 protein RPD_0400 Rhodopseudomonas palustris (strain BisB5)
C1CZ90 2.92e-08 51 35 2 88 3 Deide_03080 UPF0102 protein Deide_03080 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B8EP34 4.09e-08 51 40 1 79 3 Msil_0293 UPF0102 protein Msil_0293 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A4YJR8 4.32e-08 51 32 2 106 3 BRADO0179 UPF0102 protein BRADO0179 Bradyrhizobium sp. (strain ORS 278)
A9IXC8 4.34e-08 51 32 3 107 3 BT_1882 UPF0102 protein BT_1882 Bartonella tribocorum (strain CIP 105476 / IBS 506)
C3L0D8 4.55e-08 51 25 0 81 3 CLJ_B2665 UPF0102 protein CLJ_B2665 Clostridium botulinum (strain 657 / Type Ba4)
A9B5H2 5.55e-08 50 41 0 70 3 Haur_0145 UPF0102 protein Haur_0145 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q72DU6 6.13e-08 51 33 2 113 3 DVU_0833 UPF0102 protein DVU_0833 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1VFE8 6.13e-08 51 33 2 113 3 Dvul_2148 UPF0102 protein Dvul_2148 Nitratidesulfovibrio vulgaris (strain DP4)
A4J649 6.33e-08 50 32 2 95 3 Dred_2035 UPF0102 protein Dred_2035 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A5E8I4 6.49e-08 51 31 2 106 3 BBta_0181 UPF0102 protein BBta_0181 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A5CQR8 9.53e-08 50 37 0 77 3 CMM_1377 UPF0102 protein CMM_1377 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q0AK98 1.05e-07 50 30 2 94 3 Mmar10_3014 UPF0102 protein Mmar10_3014 Maricaulis maris (strain MCS10)
Q0RDP9 1.1e-07 50 31 1 94 3 FRAAL5785 UPF0102 protein FRAAL5785 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q1D6H9 1.17e-07 50 35 0 80 3 MXAN_3551 UPF0102 protein MXAN_3551 Myxococcus xanthus (strain DK1622)
A6GVQ6 1.18e-07 50 30 1 96 3 FP2501 UPF0102 protein FP2501 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q98DM8 1.2e-07 50 33 2 101 3 mlr4633 UPF0102 protein mlr4633 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C0QKT7 1.22e-07 50 30 0 81 3 HRM2_30940 UPF0102 protein HRM2_30940 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A8L6C8 1.24e-07 50 30 1 94 3 Franean1_1156 UPF0102 protein Franean1_1156 Parafrankia sp. (strain EAN1pec)
Q2JWE4 1.29e-07 50 35 4 111 3 CYA_0708 UPF0102 protein CYA_0708 Synechococcus sp. (strain JA-3-3Ab)
Q6G2H1 1.51e-07 49 32 2 101 3 BH12350 UPF0102 protein BH12350 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A0Q0X6 1.54e-07 49 33 0 78 3 NT01CX_2205 UPF0102 protein NT01CX_2205 Clostridium novyi (strain NT)
Q2RJT6 1.58e-07 49 37 2 104 3 Moth_0988 UPF0102 protein Moth_0988 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2J704 1.63e-07 49 31 1 94 3 Francci3_3586 UPF0102 protein Francci3_3586 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0QVA9 1.89e-07 49 36 1 84 3 MSMEG_2508 UPF0102 protein MSMEG_2508/MSMEI_2448 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q6NGK0 2.63e-07 49 35 3 82 3 DIP1513 UPF0102 protein DIP1513 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6FZ21 3.22e-07 48 31 2 101 3 BQ09720 UPF0102 protein BQ09720 Bartonella quintana (strain Toulouse)
A0QJ36 3.7e-07 48 37 1 81 3 MAV_3752 UPF0102 protein MAV_3752 Mycobacterium avium (strain 104)
Q9ZL19 5.85e-07 48 31 1 83 3 jhp_0762 UPF0102 protein jhp_0762 Helicobacter pylori (strain J99 / ATCC 700824)
A0LCU4 5.89e-07 48 28 3 118 3 Mmc1_3298 UPF0102 protein Mmc1_3298 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B8G6B1 6.03e-07 48 34 2 104 3 Cagg_0930 UPF0102 protein Cagg_0930 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q6AEA8 6.87e-07 48 35 0 70 3 Lxx14785 UPF0102 protein Lxx14785 Leifsonia xyli subsp. xyli (strain CTCB07)
Q1CT46 7.31e-07 47 30 1 83 3 HPAG1_0809 UPF0102 protein HPAG1_0809 Helicobacter pylori (strain HPAG1)
B6JM54 8.2e-07 47 30 1 83 3 HPP12_0830 UPF0102 protein HPP12_0830 Helicobacter pylori (strain P12)
O25499 8.2e-07 47 30 1 83 3 HP_0823 UPF0102 protein HP_0823 Helicobacter pylori (strain ATCC 700392 / 26695)
B9LLE9 8.35e-07 47 31 2 107 3 Chy400_2915 UPF0102 protein Chy400_2915 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WJJ9 8.35e-07 47 31 2 107 3 Caur_2698 UPF0102 protein Caur_2698 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A6UFD1 1.07e-06 47 34 2 95 3 Smed_3545 UPF0102 protein Smed_3545 Sinorhizobium medicae (strain WSM419)
Q8UIJ2 1.4e-06 47 32 2 101 3 Atu0303 UPF0102 protein Atu0303 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q895L7 1.64e-06 47 28 1 94 3 CTC_01256 UPF0102 protein CTC_01256 Clostridium tetani (strain Massachusetts / E88)
Q7W3J1 1.89e-06 47 45 0 53 3 BPP4042 UPF0102 protein BPP4042 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q83I01 2.15e-06 46 30 2 98 3 TW312 UPF0102 protein TW312 Tropheryma whipplei (strain TW08/27)
A0RMR3 2.27e-06 46 27 2 110 3 CFF8240_0294 UPF0102 protein CFF8240_0294 Campylobacter fetus subsp. fetus (strain 82-40)
B2UT06 2.59e-06 46 28 1 83 3 HPSH_02690 UPF0102 protein HPSH_02690 Helicobacter pylori (strain Shi470)
B4S950 2.72e-06 46 33 2 105 3 Paes_0016 UPF0102 protein Paes_0016 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2KDE4 2.87e-06 46 29 2 104 3 RHE_CH00320 UPF0102 protein RHE_CH00320 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q82JX1 3.36e-06 46 28 2 98 3 SAV_2633 UPF0102 protein SAV_2633/SAV2633 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B5Z7I8 3.44e-06 46 28 1 83 3 HPG27_782 UPF0102 protein HPG27_782 Helicobacter pylori (strain G27)
A9BFT1 4.13e-06 45 29 1 82 3 Pmob_0702 UPF0102 protein Pmob_0702 Petrotoga mobilis (strain DSM 10674 / SJ95)
B2A2P1 4.27e-06 45 35 2 96 3 Nther_1376 UPF0102 protein Nther_1376 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q2IJ48 4.69e-06 46 35 2 81 3 Adeh_1910 UPF0102 protein Adeh_1910 Anaeromyxobacter dehalogenans (strain 2CP-C)
B9K6M6 5.79e-06 45 27 2 99 3 CTN_0433 UPF0102 protein CTN_0433 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q3AXF2 6.79e-06 45 37 2 78 3 Syncc9902_1284 UPF0102 protein Syncc9902_1284 Synechococcus sp. (strain CC9902)
Q83G68 6.82e-06 45 29 2 98 3 TWT_455 UPF0102 protein TWT_455 Tropheryma whipplei (strain Twist)
A8F4Z9 7.15e-06 45 31 2 103 3 Tlet_0667 UPF0102 protein Tlet_0667 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A1VXN2 7.93e-06 45 36 0 55 3 CJJ81176_0184 UPF0102 protein CJJ81176_0184 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIX9 7.93e-06 45 36 0 55 3 Cj0148c UPF0102 protein Cj0148c Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FJV7 7.93e-06 45 36 0 55 3 C8J_0145 UPF0102 protein C8J_0145 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HX17 7.93e-06 45 36 0 55 3 CJE0144 UPF0102 protein CJE0144 Campylobacter jejuni (strain RM1221)
A7HBQ4 8.01e-06 45 35 2 88 3 Anae109_1947 UPF0102 protein Anae109_1947 Anaeromyxobacter sp. (strain Fw109-5)
A8ERF6 8.14e-06 45 25 2 85 3 Abu_0255 UPF0102 protein Abu_0255 Aliarcobacter butzleri (strain RM4018)
A6L1J0 8.82e-06 45 30 4 98 3 BVU_1879 UPF0102 protein BVU_1879 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q0BTH9 9.21e-06 45 30 2 97 3 GbCGDNIH1_0975 UPF0102 protein GbCGDNIH1_0975 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
O69890 1.03e-05 45 29 2 98 3 SCO5602 UPF0102 protein SCO5602 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7HN69 1.18e-05 45 43 0 46 3 Fnod_1509 UPF0102 protein Fnod_1509 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A7H1M6 1.34e-05 44 34 0 55 3 JJD26997_0163 UPF0102 protein JJD26997_0163 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B0C8B9 1.59e-05 45 29 5 107 3 AM1_3954 UPF0102 protein AM1_3954 Acaryochloris marina (strain MBIC 11017)
Q7UM23 2.38e-05 44 31 2 98 3 RB9115 UPF0102 protein RB9115 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q92SN4 2.6e-05 43 32 2 95 3 R00337 UPF0102 protein R00337 Rhizobium meliloti (strain 1021)
C3MCV0 2.66e-05 43 31 2 95 3 NGR_c36770 UPF0102 protein NGR_c36770 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7MSG7 2.68e-05 43 34 2 81 3 WS0451 UPF0102 protein WS0451 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8DI54 3.18e-05 43 32 3 96 3 tll1737 UPF0102 protein tll1737 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A6Q599 3.67e-05 43 27 1 83 3 NIS_1551 UPF0102 protein NIS_1551 Nitratiruptor sp. (strain SB155-2)
O66457 4.22e-05 42 34 2 87 3 aq_041 UPF0102 protein aq_041 Aquifex aeolicus (strain VF5)
B1L9Q0 4.53e-05 43 29 3 102 3 TRQ2_0695 UPF0102 protein TRQ2_0695 Thermotoga sp. (strain RQ2)
A5IKG8 4.53e-05 43 29 3 102 3 Tpet_0671 UPF0102 protein Tpet_0671 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WY95 4.53e-05 43 29 3 102 3 TM_0253 UPF0102 protein TM_0253 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1M445 6.67e-05 42 35 1 85 3 Mrad2831_2938 UPF0102 protein Mrad2831_2938 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q16B02 9.49e-05 42 30 3 86 3 RD1_1191 UPF0102 protein RD1_1191 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2NAK2 9.63e-05 42 34 1 66 3 ELI_05985 UPF0102 protein ELI_05985 Erythrobacter litoralis (strain HTCC2594)
B5ZYH2 9.76e-05 42 30 2 95 3 Rleg2_4331 UPF0102 protein Rleg2_4331 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q17XU9 0.000112 42 30 1 83 3 Hac_0727 UPF0102 protein Hac_0727 Helicobacter acinonychis (strain Sheeba)
Q1IJG5 0.000196 42 30 2 98 3 Acid345_3985 UPF0102 protein Acid345_3985 Koribacter versatilis (strain Ellin345)
Q5LWE2 0.000333 40 29 3 115 3 SPO0400 UPF0102 protein SPO0400 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A5V3S4 0.000336 40 32 3 97 3 Swit_0572 UPF0102 protein Swit_0572 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5G0S4 0.000414 40 33 1 68 3 Acry_2261 UPF0102 protein Acry_2261 Acidiphilium cryptum (strain JF-5)
B0T377 0.000436 40 29 2 101 3 Caul_0175 UPF0102 protein Caul_0175 Caulobacter sp. (strain K31)
Q30PA6 0.00057 40 25 1 85 3 Suden_1901 UPF0102 protein Suden_1901 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1GWI7 0.000599 40 30 3 92 3 Sala_0262 UPF0102 protein Sala_0262 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q7WEW6 0.000619 40 48 0 41 3 BB4515 UPF0102 protein BB4515 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7V7V8 0.00062 40 30 4 95 3 PMT_0624 UPF0102 protein PMT_0624 Prochlorococcus marinus (strain MIT 9313)
A3DDG4 0.000648 40 29 2 96 3 Cthe_0758 UPF0102 protein Cthe_0758 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9ABS7 0.000799 40 33 1 81 3 CC_0143 UPF0102 protein CC_0143 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8GXN3 0.000799 40 33 1 81 3 CCNA_00142 UPF0102 protein CCNA_00142 Caulobacter vibrioides (strain NA1000 / CB15N)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18365
Feature type CDS
Gene -
Product YraN family protein
Location 4030210 - 4030587 (strand: -1)
Length 378 (nucleotides) / 125 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_708
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02021 Uncharacterised protein family UPF0102

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0792 Replication, recombination and repair (L) L Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07460 putative endonuclease - -

Protein Sequence

MIIPKSTYLVGQYYERKALNYLRQQGLKLIERNVRYPCGEIDLIMQGNRTWIFVEVRFRRSAQFGDAISSVTYSKRRRLWYAANCWLAQRQQSIETVNCRFDICAFDQRQLIWLKNILDHTEFIR

Flanking regions ( +/- flanking 50bp)

CTTTACCTTGAGGCGGTTTATTTATAAGAGATAACATCAGGAAATCATGGATGATTATTCCTAAAAGTACTTATCTAGTCGGACAATATTATGAGAGAAAAGCGTTAAATTACTTGCGCCAACAAGGGTTAAAGTTAATTGAGCGTAATGTCCGATATCCCTGTGGAGAAATTGATCTTATTATGCAGGGTAATAGAACATGGATATTTGTTGAAGTCCGCTTTCGGCGTAGTGCACAATTTGGTGATGCAATCAGCTCAGTGACCTACAGTAAACGGCGCCGCTTATGGTACGCCGCCAATTGTTGGTTAGCTCAACGCCAACAAAGTATCGAGACGGTTAACTGTCGCTTTGATATTTGTGCATTTGATCAACGCCAGTTAATATGGCTAAAAAACATTCTCGATCATACGGAATTTATTCGTTAAATTAGATTATATAGGTCTTAACGTGCTTGATAGAATAAAAGTCTGCTTTA