Homologs in group_800

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03215 FBDBKF_03215 84.3 Morganella morganii S1 mlaF phospholipid ABC transporter ATP-binding protein MlaF
EHELCC_07320 EHELCC_07320 84.3 Morganella morganii S2 mlaF phospholipid ABC transporter ATP-binding protein MlaF
NLDBIP_07645 NLDBIP_07645 84.3 Morganella morganii S4 mlaF phospholipid ABC transporter ATP-binding protein MlaF
LHKJJB_07180 LHKJJB_07180 84.3 Morganella morganii S3 mlaF phospholipid ABC transporter ATP-binding protein MlaF
HKOGLL_03750 HKOGLL_03750 84.3 Morganella morganii S5 mlaF phospholipid ABC transporter ATP-binding protein MlaF
F4V73_RS11705 F4V73_RS11705 82.4 Morganella psychrotolerans mlaF phospholipid ABC transporter ATP-binding protein MlaF

Distribution of the homologs in the orthogroup group_800

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_800

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P63386 2.73e-144 408 80 0 260 1 mlaF Intermembrane phospholipid transport system ATP-binding protein MlaF Escherichia coli (strain K12)
P63387 2.73e-144 408 80 0 260 3 mlaF Intermembrane phospholipid transport system ATP-binding protein MlaF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63388 2.73e-144 408 80 0 260 3 mlaF Intermembrane phospholipid transport system ATP-binding protein MlaF Escherichia coli O157:H7
P45031 1.07e-119 345 67 0 260 1 mlaF Intermembrane phospholipid transport system ATP-binding protein MlaF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30769 3.37e-57 189 40 0 244 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium leprae (strain TN)
P9WQL5 1.13e-54 183 39 0 244 1 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL4 1.13e-54 183 39 0 244 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63358 1.13e-54 183 39 0 244 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q3A9G5 4.34e-47 163 35 4 250 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7VM95 1.11e-45 159 35 4 254 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65VG9 1.43e-44 156 33 5 257 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9AT00 2.05e-44 156 33 5 269 1 TGD3 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic Arabidopsis thaliana
Q7M816 2.06e-44 155 38 1 222 3 metN Methionine import ATP-binding protein MetN Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9JZW0 2.25e-44 156 38 4 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JUX4 4.34e-44 155 38 4 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q67SV5 1.92e-43 153 36 3 241 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q74IV9 6.64e-43 152 33 3 244 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
O31339 8.92e-43 152 36 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9CK97 1.36e-42 151 36 2 219 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q81GU1 1.74e-42 151 37 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q89UD2 2.03e-42 150 39 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8CTB2 2.99e-42 150 35 1 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQQ9 6.49e-42 149 35 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q87RS1 2.48e-41 148 33 4 256 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P56344 6.52e-41 144 36 3 228 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q609Q1 7.02e-41 147 37 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q043Y8 7.64e-41 147 32 4 252 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q4JTG9 9.99e-41 147 37 2 223 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q8D0W8 1.34e-40 146 36 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
P44785 2.34e-40 145 35 1 216 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q668K6 2.75e-40 145 36 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q65S66 2.81e-40 145 35 3 237 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0BMC9 6.07e-40 144 34 4 262 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 6.07e-40 144 34 4 262 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q4QMH4 7.33e-40 144 34 1 216 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q9I6L0 7.77e-40 144 37 3 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q14H97 1.05e-39 144 34 4 262 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
P40860 1.55e-39 144 36 4 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z4V6 1.57e-39 144 36 4 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q4QK57 1.66e-39 144 35 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q8XBJ8 1.87e-39 144 36 3 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q8DIA0 2.14e-39 142 36 3 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8FFB3 2.19e-39 143 36 3 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16676 2.22e-39 143 36 3 233 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q5NFU5 2.25e-39 143 34 4 262 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q4L4R9 3.28e-39 142 34 2 219 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
O85818 3.29e-39 143 36 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q5HV18 3.41e-39 142 34 2 253 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 3.41e-39 142 34 2 253 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8E8K8 3.61e-39 142 35 3 243 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7MN25 6.12e-39 142 32 4 256 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q7UC29 8.35e-39 142 35 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q97UY8 1.24e-38 141 33 2 230 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q7N6Z2 1.28e-38 141 36 4 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8DFC3 1.42e-38 140 33 4 251 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q7N8M2 1.44e-38 140 34 2 232 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6F9A8 1.53e-38 141 35 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88AS5 1.74e-38 140 37 3 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9X196 1.85e-38 141 34 2 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P45171 2.55e-38 140 35 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q03AH0 2.87e-38 140 33 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P39456 2.95e-38 137 33 5 245 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q7W9U5 3.04e-38 140 36 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2SSS4 3.04e-38 140 33 3 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8RI39 3.27e-38 140 36 3 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6NBT1 3.28e-38 140 38 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5E715 4.18e-38 139 32 4 256 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6MU19 4.58e-38 139 33 3 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q9KTJ5 4.74e-38 139 33 4 251 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q667L9 4.89e-38 139 33 3 241 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7WGW1 5.53e-38 139 36 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8F6Z1 5.71e-38 139 36 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 5.71e-38 139 36 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q895C4 6.75e-38 138 33 1 238 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q04G50 7.12e-38 139 33 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q24QI5 7.3e-38 139 32 3 251 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
P37009 7.77e-38 139 33 2 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q6D201 9.08e-38 138 35 4 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LN52 1.02e-37 138 33 4 256 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q7VZE5 1.13e-37 139 35 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q6D1C4 1.26e-37 138 32 3 239 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q32JQ8 1.51e-37 138 33 3 239 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q49W48 1.54e-37 138 34 1 217 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3Z5F8 1.94e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 1.94e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 1.94e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 1.94e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q0TLD2 2.01e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9KLQ5 2.09e-37 138 32 2 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8UA73 2.25e-37 137 32 6 279 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0I5E9 2.56e-37 137 32 2 239 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q88ZJ6 2.82e-37 138 34 3 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P30750 2.93e-37 137 33 3 239 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q88CL2 3.32e-37 137 36 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8RFN2 3.44e-37 137 35 1 218 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q660M8 3.77e-37 137 32 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q9G4F5 3.8e-37 137 35 3 231 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q6LKD4 4.27e-37 137 32 2 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q325U1 4.47e-37 137 33 3 239 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q7NIW1 4.51e-37 137 35 3 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
O26096 5.75e-37 136 34 1 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CFH7 5.81e-37 136 33 3 241 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 5.81e-37 136 33 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 5.81e-37 136 33 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8EUJ1 6.05e-37 135 32 8 252 3 pstB Phosphate import ATP-binding protein PstB Malacoplasma penetrans (strain HF-2)
Q03ZQ0 7.37e-37 137 33 3 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q7NX01 7.56e-37 136 35 2 231 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1B677 8.15e-37 136 33 1 229 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q9CP06 1.09e-36 136 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8NXH5 1.11e-36 135 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 1.11e-36 135 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 1.11e-36 135 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 1.11e-36 135 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 1.11e-36 135 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q1WVG9 1.18e-36 136 33 4 242 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q3KCC5 1.18e-36 136 34 6 262 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q63TY1 1.2e-36 136 35 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q62K82 1.26e-36 135 35 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q74K65 1.27e-36 136 38 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9MUN1 1.54e-36 135 34 3 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
O51587 1.54e-36 135 32 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q83MC5 1.63e-36 135 33 3 233 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.63e-36 135 33 3 233 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q6A6X6 1.66e-36 135 33 5 248 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q8EPK1 1.67e-36 135 29 4 251 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8Z990 1.75e-36 135 31 4 256 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q7VNG4 1.86e-36 135 32 4 268 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8ZRM9 1.91e-36 135 31 4 256 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PID0 1.99e-36 135 31 4 256 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8PC11 1.99e-36 135 38 3 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q0SFW6 2.15e-36 135 35 2 224 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q5L222 2.15e-36 135 35 4 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q57T09 2.23e-36 135 31 4 256 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q2SY12 2.35e-36 135 31 2 243 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9K876 2.4e-36 135 34 3 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7AH43 2.42e-36 135 33 2 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q93DX8 2.44e-36 133 35 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q8NSN2 2.71e-36 135 35 2 236 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q07LR5 2.77e-36 135 31 3 257 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
Q8PNN4 3.2e-36 134 40 3 200 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q6FAN3 3.47e-36 135 32 2 232 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6F0V4 3.57e-36 134 31 2 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q7N8B9 4.54e-36 134 32 2 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ELQ6 4.92e-36 134 31 4 245 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q81IZ6 5.39e-36 134 29 3 251 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P46920 5.89e-36 135 34 3 231 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
E0SCY1 5.95e-36 135 36 3 222 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q2YWP2 6.07e-36 134 33 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q63S19 6.52e-36 134 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 6.52e-36 134 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 6.52e-36 134 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q82WT5 7.46e-36 134 36 4 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q6D734 7.74e-36 134 32 2 230 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9KS33 8.91e-36 134 36 2 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q32EY4 9.08e-36 134 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
P74548 9.11e-36 134 35 3 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Z0H0 9.97e-36 133 35 3 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q63H29 1.03e-35 133 30 4 251 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q0SML1 1.12e-35 133 32 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q6GIH9 1.14e-35 133 32 1 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q0I3Y9 1.26e-35 134 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q8D653 1.43e-35 133 33 3 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q98G43 1.56e-35 133 34 4 240 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3Z2Z3 1.61e-35 133 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.61e-35 133 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q65T42 1.61e-35 133 35 3 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9RR46 1.74e-35 134 33 3 225 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q7A6M2 1.91e-35 132 32 1 217 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 1.91e-35 132 32 1 217 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9PDN2 1.94e-35 132 37 2 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q5X484 2.28e-35 132 30 1 237 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
O83658 2.32e-35 133 36 2 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q042G7 2.59e-35 132 37 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
O34900 2.66e-35 130 32 3 244 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q9PBK0 2.81e-35 130 33 6 242 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain 9a5c)
Q17VE0 3.12e-35 131 32 1 223 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q1RD28 3.42e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 3.42e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q1CR30 3.46e-35 131 33 1 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q9ZJ34 3.54e-35 131 32 1 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q21BU8 3.78e-35 132 30 3 252 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
P14788 4.41e-35 131 36 4 232 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1GB17 4.81e-35 132 35 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q38WL5 5.21e-35 131 34 2 218 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q87DT9 5.3e-35 131 37 2 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8U6M1 5.31e-35 131 33 3 236 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
P69877 6.25e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 6.25e-35 132 34 3 239 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 6.25e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 6.25e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 6.25e-35 132 34 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q87C88 6.4e-35 129 33 6 242 3 pstB Phosphate import ATP-binding protein PstB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q97KD5 6.87e-35 130 30 1 246 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q81VM2 7.2e-35 131 29 4 251 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q0AU85 7.2e-35 131 31 4 251 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q7M8M4 8.38e-35 129 33 2 217 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7NWX3 8.73e-35 131 37 4 227 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0SFY5 9.84e-35 130 33 3 237 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q6G2E2 1.01e-34 130 31 1 211 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5HQ70 1.03e-34 131 33 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6N9W0 1.03e-34 131 33 2 228 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8GEH7 1.08e-34 130 33 3 229 3 metN Methionine import ATP-binding protein MetN Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q88UV2 1.15e-34 130 32 3 243 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P10091 1.15e-34 131 34 2 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
Q18C09 1.15e-34 130 31 1 225 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q8NQU4 1.4e-34 128 31 4 250 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9A7X1 1.42e-34 130 34 3 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9KIF7 1.42e-34 131 35 3 227 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
Q81IN8 1.48e-34 130 32 2 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5WVL8 1.62e-34 130 30 1 237 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q9CM80 1.64e-34 130 33 3 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q8UH62 1.91e-34 130 35 2 214 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1DDP4 1.92e-34 129 33 2 230 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q6N798 1.97e-34 130 32 2 246 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q63GR8 1.98e-34 130 32 2 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
P44531 2.11e-34 129 33 3 232 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6ME20 2.13e-34 130 31 3 269 3 metN Methionine import ATP-binding protein MetN Protochlamydia amoebophila (strain UWE25)
Q5ZUG5 2.34e-34 129 30 1 237 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5FKL2 2.4e-34 130 31 5 251 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q65UE1 2.46e-34 130 33 2 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9TKX3 2.68e-34 129 33 3 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q5XCA4 2.72e-34 130 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q13LD8 2.78e-34 130 33 2 212 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q03Z27 2.83e-34 130 31 4 253 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P0CZ35 2.95e-34 130 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 2.95e-34 130 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 2.95e-34 130 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1BR30 2.99e-34 130 34 1 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 2.99e-34 130 34 1 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q0I2Z4 3.17e-34 129 32 3 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
P27675 3.2e-34 127 31 3 241 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q39AT4 3.48e-34 130 34 1 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1MQ44 3.67e-34 129 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q8YA75 4.01e-34 129 31 1 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1QE80 4.03e-34 130 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q134N9 4.25e-34 129 32 2 228 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
P17328 4.28e-34 130 35 3 222 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83F44 4.37e-34 129 30 2 237 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q04BG2 4.4e-34 129 35 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q9A502 4.58e-34 129 33 1 206 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q0T5R2 4.61e-34 129 33 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
P9WQM1 4.7e-34 129 35 2 213 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 4.7e-34 129 35 2 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 4.7e-34 129 35 2 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6HP89 4.84e-34 129 32 2 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q1J6Q6 4.86e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 4.86e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 4.86e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 4.86e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5KVK2 4.92e-34 129 31 2 232 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q724C0 4.95e-34 129 31 1 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q73F11 5.26e-34 129 29 4 251 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8ELR4 5.3e-34 129 34 3 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1WVI7 5.31e-34 129 31 2 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q578K3 5.77e-34 129 35 2 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 5.77e-34 129 35 2 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q7MKU3 6.2e-34 129 35 2 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 6.2e-34 129 35 2 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q73XU8 6.21e-34 129 34 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q5FL41 6.29e-34 129 36 2 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7CN92 6.3e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 6.3e-34 129 33 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q92LX3 6.81e-34 129 33 2 228 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q5WKL3 6.83e-34 128 29 4 262 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q73EL7 6.83e-34 128 32 2 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q832Y6 6.99e-34 129 33 2 210 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CPN0 8.44e-34 129 33 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P14175 8.57e-34 129 35 3 222 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q92WJ0 8.67e-34 128 34 2 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q1BY14 8.81e-34 128 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 8.81e-34 128 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q8FRX8 1e-33 128 33 2 236 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q7CHF8 1.04e-33 127 34 1 213 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 1.04e-33 127 34 1 213 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 1.04e-33 127 34 1 213 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 1.04e-33 127 34 1 213 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q81ZF5 1.11e-33 127 32 2 228 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q5E586 1.15e-33 128 32 2 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
P31134 1.16e-33 128 34 3 229 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q8DPC2 1.2e-33 129 33 3 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 1.2e-33 129 33 3 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 1.2e-33 129 33 3 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q87PH3 1.21e-33 128 35 2 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5ZWE4 1.41e-33 128 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8FV85 1.42e-33 128 31 1 237 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.42e-33 128 31 1 237 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.42e-33 128 31 1 237 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.42e-33 128 31 1 237 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
P0CZ31 1.54e-33 127 33 3 245 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
Q1JNE0 1.54e-33 127 33 3 245 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 1.54e-33 127 33 3 245 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0CZ30 1.54e-33 127 33 3 245 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q47RE8 1.54e-33 127 36 1 210 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q5XDS8 1.62e-33 127 34 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5JEB0 1.65e-33 127 33 4 233 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q97KS6 1.66e-33 127 32 2 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9X0Y8 1.68e-33 125 32 8 251 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5E882 1.91e-33 124 33 4 224 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q72FW5 1.92e-33 127 35 3 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q93DA2 2.19e-33 127 34 3 231 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q92VJ2 2.25e-33 127 34 3 231 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q6D3Q6 2.3e-33 127 32 3 248 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q830W6 2.49e-33 127 33 2 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q12BB2 2.49e-33 125 32 6 240 3 pstB Phosphate import ATP-binding protein PstB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q48V78 2.53e-33 127 34 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 2.53e-33 127 34 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
P45022 2.61e-33 125 31 4 244 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q48CA0 2.61e-33 125 35 4 229 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8P2K6 2.7e-33 127 34 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q92EZ6 2.72e-33 127 30 1 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q13VD7 3.06e-33 127 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q2NRN5 3.06e-33 127 32 2 230 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q31ZH4 3.31e-33 124 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q39IE7 3.47e-33 126 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8XZP8 3.77e-33 127 35 2 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5YZY9 3.97e-33 126 33 3 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q5WXF0 4.24e-33 127 34 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q1QVQ7 4.47e-33 126 33 2 224 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8E3S0 4.52e-33 126 31 3 256 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q1JII9 4.64e-33 126 34 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7VI92 4.72e-33 126 33 2 225 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q38VW6 4.92e-33 126 31 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q3Z300 5.01e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 5.01e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 5.01e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 5.01e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q2K8C8 5.33e-33 126 33 2 230 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8U4K3 5.38e-33 126 33 4 233 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q85A69 5.41e-33 127 31 2 228 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
Q3KJS6 5.44e-33 127 30 1 233 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q8FVV5 5.55e-33 126 34 2 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q6AE21 5.77e-33 126 33 3 240 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q32EX7 5.82e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
O34677 5.82e-33 123 33 5 242 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q0B6I6 5.93e-33 127 33 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q83RS0 6.82e-33 123 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q9CNP9 7.04e-33 122 37 4 197 3 thiQ Thiamine import ATP-binding protein ThiQ Pasteurella multocida (strain Pm70)
Q8DY54 7.08e-33 126 31 4 258 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 7.08e-33 126 31 4 258 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q87UN4 8.04e-33 125 33 0 209 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5WBL0 8.23e-33 123 34 3 213 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q7VV72 8.3e-33 126 32 2 237 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 8.3e-33 126 32 2 237 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 8.3e-33 126 32 2 237 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q49WM4 9.35e-33 125 31 3 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8X8E3 9.68e-33 122 38 4 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q3J1N0 9.75e-33 125 32 2 231 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P75957 1e-32 122 38 4 205 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q4KK46 1.08e-32 126 31 1 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8DZJ0 1.25e-32 126 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.25e-32 126 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.25e-32 126 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q58488 1.25e-32 124 33 7 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3CMQ7 1.26e-32 126 32 3 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q8YCG3 1.36e-32 125 34 2 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q5WDP1 1.42e-32 125 31 2 231 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q5YRD1 1.45e-32 125 33 3 224 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q1J8E4 1.55e-32 125 33 5 247 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q92UV5 1.62e-32 125 36 2 210 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q2RWA3 1.63e-32 125 29 2 236 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8Z7H7 1.8e-32 125 33 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q5PMK1 2.04e-32 125 33 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q03A07 2.08e-32 124 32 3 236 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q3K506 2.09e-32 122 35 3 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q6KHL1 2.27e-32 122 32 5 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q2JLH7 2.28e-32 122 36 2 188 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
P37774 2.39e-32 122 34 5 251 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q04F14 2.43e-32 124 31 4 245 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8ELA5 2.57e-32 124 27 3 251 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q65M34 2.77e-32 124 29 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P40790 3.25e-32 124 33 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 3.25e-32 124 33 3 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q8PAG0 3.28e-32 122 31 6 249 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT63 3.28e-32 122 31 6 249 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas campestris pv. campestris (strain 8004)
Q5WJP0 3.29e-32 124 32 3 246 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q4L5B3 3.39e-32 124 31 5 248 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q0BH79 3.86e-32 124 30 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q14Q07 4.09e-32 124 31 2 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q0P9X7 4.1e-32 121 31 5 243 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q831K6 4.14e-32 124 30 4 247 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
A1VZQ5 4.23e-32 121 31 5 243 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q8Z8R5 4.39e-32 123 32 2 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
P10346 4.48e-32 121 34 7 246 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
O29527 4.55e-32 122 34 4 222 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q4FL37 4.94e-32 123 34 4 228 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Pelagibacter ubique (strain HTCC1062)
Q57S53 5.03e-32 123 32 2 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
P45092 5.08e-32 121 31 3 241 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4KC87 5.14e-32 124 34 4 239 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3YVL7 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Shigella sonnei (strain Ss046)
P0AAH3 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Shigella flexneri
Q329R2 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Shigella dysenteriae serotype 1 (strain Sd197)
Q31UX2 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Shigella boydii serotype 4 (strain Sb227)
Q1R4L0 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Escherichia coli (strain UTI89 / UPEC)
P0AAH0 5.23e-32 121 32 8 249 1 pstB Phosphate import ATP-binding protein PstB Escherichia coli (strain K12)
P0AAH1 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAY4 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0AAH2 5.23e-32 121 32 8 249 3 pstB Phosphate import ATP-binding protein PstB Escherichia coli O157:H7
A3DDF6 5.5e-32 124 32 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5PCG9 5.7e-32 123 32 2 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0SWH9 5.7e-32 122 32 5 226 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q6LR20 6.01e-32 124 33 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
O27739 6.22e-32 122 32 7 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5X627 6.52e-32 124 34 3 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q221H2 6.69e-32 121 32 7 247 3 pstB Phosphate import ATP-binding protein PstB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8ZR89 7.09e-32 123 32 2 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4K441 7.26e-32 121 35 5 226 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q24XJ2 7.37e-32 123 32 2 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
Q8XIZ5 7.99e-32 123 30 5 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 7.99e-32 123 30 5 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q02ME3 8.93e-32 123 30 1 235 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q87UI3 9.19e-32 121 36 5 229 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3SVB5 9.43e-32 121 32 8 252 3 pstB Phosphate import ATP-binding protein PstB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
O32169 9.73e-32 122 29 3 225 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q57293 9.97e-32 123 31 6 269 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q8A883 1.19e-31 124 32 3 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8PM59 1.22e-31 120 31 7 249 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas axonopodis pv. citri (strain 306)
Q0SRL2 1.26e-31 122 29 6 274 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q3BV68 1.35e-31 120 31 7 249 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P96063 1.38e-31 123 35 4 224 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5M5Z2 1.59e-31 122 31 5 245 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q8Y0X3 1.6e-31 122 30 1 220 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9XBG1 1.65e-31 120 32 7 242 3 pstB Phosphate import ATP-binding protein PstB Burkholderia sp.
Q4ZZR8 1.71e-31 122 32 1 218 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q8D3Z9 1.72e-31 125 29 4 235 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 2.4e-19 90 28 7 238 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q2KVK2 1.72e-31 122 31 2 237 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q5M1F6 1.75e-31 122 30 7 257 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q2NHW1 1.88e-31 120 30 6 258 3 pstB Phosphate import ATP-binding protein PstB Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q5PFQ7 1.9e-31 122 34 4 224 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D4E2 1.9e-31 122 32 2 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65F80 1.93e-31 122 32 1 201 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8Z8W8 2e-31 122 34 4 224 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q8EBC3 2.01e-31 122 33 5 266 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87AL9 2.13e-31 122 32 2 219 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P47650 2.16e-31 121 33 8 245 3 pstB Phosphate import ATP-binding protein PstB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q3M5J9 2.28e-31 119 34 2 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q6NJ07 2.29e-31 122 33 2 227 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5H002 2.36e-31 120 31 7 242 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2Y5 2.36e-31 120 31 7 242 3 pstB Phosphate import ATP-binding protein PstB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q57SD6 2.36e-31 122 34 4 224 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q7MFH3 2.38e-31 125 29 4 235 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 9.37e-19 89 28 7 238 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
O57896 2.7e-31 121 32 4 234 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q46ZA5 2.8e-31 119 32 7 247 3 pstB Phosphate import ATP-binding protein PstB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q71X09 2.88e-31 121 29 3 238 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
A1TXH7 3.07e-31 122 32 2 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0TUN8 3.1e-31 120 31 5 226 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q03JH1 3.11e-31 122 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M397 3.24e-31 122 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 3.24e-31 122 32 2 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q92XW1 3.48e-31 121 33 2 213 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q64SQ6 3.61e-31 123 31 3 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q18AM3 3.71e-31 121 30 3 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q5LBT4 3.92e-31 123 31 3 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q97T09 4.21e-31 121 32 3 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q3IQI3 4.43e-31 119 34 4 233 3 pstB2 Phosphate import ATP-binding protein PstB 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8PGE8 4.61e-31 120 32 2 220 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
P44871 4.89e-31 117 37 4 180 3 ftsE Cell division ATP-binding protein FtsE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0PY57 5.11e-31 121 30 2 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q8DRF9 5.12e-31 121 32 3 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8Y4L8 5.16e-31 120 29 3 237 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P63354 5.18e-31 121 33 3 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 5.18e-31 121 33 3 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YM92 5.56e-31 121 35 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q87UV4 5.81e-31 121 29 2 244 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3MAR5 6.3e-31 121 34 4 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q88WA5 6.46e-31 120 32 1 210 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87SV4 6.62e-31 118 33 6 226 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4ZLS1 6.66e-31 119 34 4 229 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q48PN3 6.86e-31 121 29 2 244 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0AGP9 6.87e-31 121 32 3 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q2SJY7 6.9e-31 121 34 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q13W55 7.33e-31 119 31 6 240 3 pstB Phosphate import ATP-binding protein PstB Paraburkholderia xenovorans (strain LB400)
P45073 7.36e-31 118 30 4 241 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3ATY5 7.62e-31 118 34 2 195 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobium chlorochromatii (strain CaD3)
Q9Z8Q8 7.64e-31 120 30 4 245 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q5HIL5 7.88e-31 120 29 3 239 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 7.88e-31 120 29 3 239 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 7.88e-31 120 29 3 239 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q4FQD1 8.68e-31 118 31 8 248 3 pstB Phosphate import ATP-binding protein PstB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q8Y8T6 8.72e-31 120 32 3 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92DL6 9.67e-31 120 32 3 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7W8Q6 9.76e-31 118 29 6 244 3 pstB Phosphate import ATP-binding protein PstB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMC3 9.76e-31 118 29 6 244 3 pstB Phosphate import ATP-binding protein PstB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5LT65 1.07e-30 120 36 3 216 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9KUI0 1.1e-30 120 34 3 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6CYN3 1.13e-30 118 32 7 250 3 pstB2 Phosphate import ATP-binding protein PstB 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9AML4 1.13e-30 118 33 9 249 3 pstB Phosphate import ATP-binding protein PstB Edwardsiella tarda
Q254K9 1.14e-30 120 31 4 251 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q2SUW7 1.15e-30 118 33 7 242 3 pstB Phosphate import ATP-binding protein PstB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63V79 1.15e-30 118 33 7 242 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain K96243)
Q3JTS8 1.15e-30 118 33 7 242 3 pstB Phosphate import ATP-binding protein PstB Burkholderia pseudomallei (strain 1710b)
Q9K789 1.17e-30 120 29 2 233 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O57872 1.17e-30 118 34 6 229 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9I1C8 1.22e-30 120 29 1 235 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44613 1.23e-30 117 37 4 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P63365 1.23e-30 117 32 9 249 3 pstB Phosphate import ATP-binding protein PstB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63366 1.23e-30 117 32 9 249 3 pstB Phosphate import ATP-binding protein PstB Salmonella typhi
Q5PKW4 1.23e-30 117 32 9 249 3 pstB Phosphate import ATP-binding protein PstB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q160M2 1.25e-30 120 33 3 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q4KBU0 1.27e-30 119 34 2 232 3 metN3 Methionine import ATP-binding protein MetN 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O28912 1.31e-30 117 32 7 247 3 pstB Phosphate import ATP-binding protein PstB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18185
Feature type CDS
Gene mlaF
Product phospholipid ABC transporter ATP-binding protein MlaF
Location 3991464 - 3992276 (strand: 1)
Length 813 (nucleotides) / 270 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_800
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1127 Cell wall/membrane/envelope biogenesis (M) M ATPase subunit MlaF of the ABC-type intermembrane phospholipid transporter Mla

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02065 phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein ABC transporters -

Protein Sequence

MNAQPDNLIEVRNMNFTRGSRKIFSQINLDVPRGKVTAIMGPSGIGKTTLLRLMGGQILPDSGDIWFDGDNIPKLSRSALYQSRKKMSMLFQSGALFTDMNVFENVAFPLREHTNLPEALIHTTVMMKLEAVGLRGAANLMPSELSGGMARRAALARAIALDPDLIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCVVVSHDVPEVLSIADYAYIIAEQKIIAQGSAKELQENPDRQVRQFLDGIADGPVPFRFPAGNYQDDLLGRGN

Flanking regions ( +/- flanking 50bp)

AATAGCGTATAAATTTTGTTTATGCAGACAGGCTTAAGGACGTTTTATTCATGAACGCACAACCAGACAATTTAATTGAAGTGCGCAATATGAACTTTACTCGCGGTAGCAGAAAGATTTTTTCGCAAATCAATCTGGATGTGCCTAGAGGAAAAGTGACTGCAATAATGGGGCCTTCAGGGATAGGTAAAACCACCTTATTACGCTTGATGGGGGGACAAATTCTGCCTGATAGTGGTGATATTTGGTTTGATGGTGACAATATTCCTAAGTTATCACGCTCTGCTTTATATCAGTCAAGAAAAAAAATGAGTATGCTTTTTCAATCAGGCGCCCTTTTTACTGATATGAATGTATTTGAAAATGTCGCCTTCCCATTAAGAGAGCATACTAATTTACCCGAGGCGTTAATTCACACTACCGTGATGATGAAGTTAGAAGCGGTAGGGTTAAGAGGGGCTGCTAATTTAATGCCATCTGAATTATCGGGGGGAATGGCGCGCAGAGCCGCTTTAGCAAGAGCGATAGCCCTTGATCCAGATTTAATCATGTTTGACGAGCCATTCGTTGGACAAGATCCCATTACCATGGGGGTATTAGTAAAACTGATTGATGAATTAAACCATGCATTAGGGGTCACTTGTGTGGTGGTGTCTCATGATGTCCCTGAAGTACTGAGTATTGCCGATTATGCATATATTATTGCAGAACAGAAAATCATTGCTCAGGGAAGTGCAAAAGAGCTACAGGAAAATCCAGACAGACAAGTAAGACAGTTTTTAGATGGTATTGCTGATGGACCTGTACCTTTCCGTTTTCCTGCGGGGAACTATCAGGATGATCTATTAGGACGAGGTAATTAGTACGTGGTTAATTTACTAGCGCGGTTAGGCGCGCGATCACTGTCGATTTT