Homologs in group_4784

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4784

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4784

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45566 2.2e-24 90 53 0 77 2 yhdT Uncharacterized membrane protein YhdT Escherichia coli (strain K12)
P46455 8.41e-21 81 42 1 82 4 HI_0974.1 Uncharacterized protein HI_0974.1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18040
Feature type CDS
Gene -
Product YhdT family protein
Location 3963588 - 3963836 (strand: -1)
Length 249 (nucleotides) / 82 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4784
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF06196 Protein of unknown function (DUF997)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3924 Function unknown (S) S Uncharacterized membrane protein YhdT

Protein Sequence

MDKRFVQAHKEALLALVLTFIYLLGWLLTAYLPDNSVGLTGLPVWFELSCLFLPVLFFLLCYLMVRYFFKDMPLGDEHDNAN

Flanking regions ( +/- flanking 50bp)

CCGTACAATCCTTCCCATTCGTTTTAATCCTATAAAGATTGGGAGAACAGATGGACAAGCGTTTTGTTCAGGCCCACAAAGAAGCCCTCTTGGCCTTAGTGCTTACTTTTATCTACTTATTGGGTTGGTTACTTACTGCCTATTTACCCGATAATAGTGTGGGACTAACCGGCCTACCGGTTTGGTTTGAGCTTTCATGCCTATTTTTACCTGTGCTATTTTTTTTACTGTGTTATCTGATGGTACGCTATTTTTTCAAAGATATGCCGTTAGGAGATGAGCATGACAATGCAAACTGAGGTTATCGTGCCACTGGTTGGCTATCTCTTATTGGTCTTCCTATTATCCG