Homologs in group_4718

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4718

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4718

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17390
Feature type CDS
Gene -
Product type II toxin-antitoxin system HigB family toxin
Location 3818397 - 3818675 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4718
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF09907 HigB_toxin, RelE-like toxic component of a toxin-antitoxin system

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4680 Translation, ribosomal structure and biogenesis (J)
Defense mechanisms (V)
JV mRNA-degrading endonuclease (mRNA interferase) HigB, toxic component of the HigAB toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19166 mRNA interferase HigB [EC:3.1.-.-] - -

Protein Sequence

MAMRLLGRDKLEKLVDIEPSCKRWSDLWSTEIAKSYWKSKEEVEKQFPTVINLKDKVYLFQVSNTNFKVETIIDFSKLVVLITSIKGNVDEY

Flanking regions ( +/- flanking 50bp)

ATAGTTTATCATTATGCATCTATAATGTTCCCAAGTTAGGAACTAAATCTATGGCAATGCGTTTACTCGGACGAGATAAACTAGAAAAACTTGTGGATATAGAACCTTCATGTAAACGTTGGAGCGATTTGTGGTCAACAGAAATCGCTAAGAGCTACTGGAAATCAAAAGAAGAAGTAGAAAAACAATTTCCAACAGTTATCAATCTTAAAGATAAAGTTTATTTATTTCAGGTAAGCAATACTAATTTTAAGGTGGAAACAATTATAGATTTCAGTAAATTAGTAGTTCTTATTACCTCAATAAAGGGTAATGTTGATGAATATTAAAGTTATCCGTACGGAAACTCAACATAAAGAATATCTAGAGCGCATATATT