Homologs in group_1396

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08620 FBDBKF_08620 82.5 Morganella morganii S1 yhbY ribosome assembly RNA-binding protein YhbY
EHELCC_12905 EHELCC_12905 82.5 Morganella morganii S2 yhbY ribosome assembly RNA-binding protein YhbY
NLDBIP_13245 NLDBIP_13245 82.5 Morganella morganii S4 yhbY ribosome assembly RNA-binding protein YhbY
LHKJJB_13310 LHKJJB_13310 82.5 Morganella morganii S3 yhbY ribosome assembly RNA-binding protein YhbY
HKOGLL_11720 HKOGLL_11720 82.5 Morganella morganii S5 yhbY ribosome assembly RNA-binding protein YhbY
F4V73_RS09845 F4V73_RS09845 81.4 Morganella psychrotolerans yhbY ribosome assembly RNA-binding protein YhbY

Distribution of the homologs in the orthogroup group_1396

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1396

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AGK7 5.31e-45 143 74 0 97 4 yhbY RNA-binding protein YhbY Shigella flexneri
P0AGK4 5.31e-45 143 74 0 97 1 yhbY RNA-binding protein YhbY Escherichia coli (strain K12)
P0AGK5 5.31e-45 143 74 0 97 4 yhbY RNA-binding protein YhbY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGK6 5.31e-45 143 74 0 97 4 yhbY RNA-binding protein YhbY Escherichia coli O157:H7
P71376 5.77e-42 135 71 0 96 1 HI_1333 RNA-binding protein HI_1333 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P95453 1.14e-21 84 47 0 86 4 PA4753 Probable RNA-binding protein PA4753 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54454 4.2e-14 65 38 1 95 4 yqeI Probable RNA-binding protein YqeI Bacillus subtilis (strain 168)
Q58068 7.75e-08 49 35 2 89 4 MJ0652 Probable RNA-binding protein MJ0652 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16975
Feature type CDS
Gene yhbY
Product ribosome assembly RNA-binding protein YhbY
Location 3736381 - 3736674 (strand: -1)
Length 294 (nucleotides) / 97 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1396
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01985 CRS1 / YhbY (CRM) domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1534 Translation, ribosomal structure and biogenesis (J) J RNA-binding protein YhbY

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07574 RNA-binding protein - -

Protein Sequence

MTLNKKQIQHLKGLAHHLNPVVMIGNNGLTEGVLAEIEIALAHHELIKVKIAGEDRDVKNLIVAAIVRESGAQNVQVIGKMVVLYRPSEARKIILPK

Flanking regions ( +/- flanking 50bp)

GATGGCGTTAGAATAGACCGTTTTCAATCCCAACTAAGCAAAAATTAATGATGACTCTTAACAAAAAACAAATTCAACACCTGAAAGGGCTCGCTCATCATCTCAATCCTGTCGTTATGATCGGTAACAACGGGTTGACTGAAGGCGTTCTTGCAGAAATTGAAATCGCTCTGGCACATCATGAGCTTATCAAAGTCAAAATCGCAGGCGAAGATCGAGATGTTAAAAACTTGATCGTGGCAGCGATTGTACGTGAAAGCGGTGCACAGAATGTACAAGTTATCGGAAAAATGGTTGTTCTTTATCGCCCTTCTGAAGCGCGTAAAATTATTTTACCGAAATAAAACTTATACCTTTATATAAAAATGCCATAACTAACTCTATGGCAAAAAAG