Homologs in group_1388

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08570 FBDBKF_08570 88.5 Morganella morganii S1 argR transcriptional regulator ArgR
EHELCC_12955 EHELCC_12955 88.5 Morganella morganii S2 argR transcriptional regulator ArgR
NLDBIP_13295 NLDBIP_13295 88.5 Morganella morganii S4 argR transcriptional regulator ArgR
LHKJJB_13260 LHKJJB_13260 88.5 Morganella morganii S3 argR transcriptional regulator ArgR
HKOGLL_11770 HKOGLL_11770 88.5 Morganella morganii S5 argR transcriptional regulator ArgR
F4V73_RS09795 F4V73_RS09795 89.1 Morganella psychrotolerans argR transcriptional regulator ArgR

Distribution of the homologs in the orthogroup group_1388

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1388

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2A0 1.66e-112 318 100 0 156 3 argR Arginine repressor Proteus mirabilis (strain HI4320)
A1JIU9 1.27e-96 278 85 0 156 3 argR Arginine repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1R6A2 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli (strain UTI89 / UPEC)
Q8FD52 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCM8 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGD0 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O1:K1 / APEC
B7N109 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O81 (strain ED1a)
B7MBZ8 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJW9 3.57e-96 277 85 0 156 3 argR Arginine repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1JMK2 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F81 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRK4 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pestis (strain Pestoides F)
Q1CEJ2 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R583 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBA2 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pestis
B2K2N4 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBY6 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMU3 5.35e-96 276 85 0 156 3 argR Arginine repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LRL2 7.52e-96 276 85 0 156 3 argR Arginine repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3YX10 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella sonnei (strain Ss046)
P0A6D2 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella flexneri
Q0T051 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella flexneri serotype 5b (strain 8401)
Q32BA2 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31WA5 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella boydii serotype 4 (strain Sb227)
B2U1U8 1.55e-95 275 85 0 156 3 argR Arginine repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LGK3 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain SMS-3-5 / SECEC)
B6I1V5 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain SE11)
B7NDL5 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6D0 1.55e-95 275 85 0 156 1 argR Arginine repressor Escherichia coli (strain K12)
B1IQP2 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A546 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O9:H4 (strain HS)
B1XHL0 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain K12 / DH10B)
C4ZSX5 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0U9 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O8 (strain IAI1)
B7NKV0 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSW3 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6D1 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O157:H7
B7LHT7 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli (strain 55989 / EAEC)
A7ZSD1 1.55e-95 275 85 0 156 3 argR Arginine repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MYW8 8.13e-95 273 85 0 156 3 argR Arginine repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TEQ4 9.48e-95 273 85 0 156 3 argR Arginine repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSQ5 9.48e-95 273 85 0 156 3 argR Arginine repressor Klebsiella pneumoniae (strain 342)
A4WF49 3.39e-94 272 84 0 156 3 argR Arginine repressor Enterobacter sp. (strain 638)
C5BF97 3.66e-94 272 83 0 156 3 argR Arginine repressor Edwardsiella ictaluri (strain 93-146)
A8AQC9 5.25e-94 271 83 0 156 3 argR Arginine repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8G8Y6 7.38e-94 271 82 0 156 3 argR Arginine repressor Serratia proteamaculans (strain 568)
A9MNX4 1.03e-93 271 83 0 156 3 argR Arginine repressor Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0A1B3 1.83e-93 270 83 0 156 1 argR Arginine repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1B4 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella typhi
B4TWL0 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella schwarzengrund (strain CVM19633)
B5BGR4 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella paratyphi A (strain AKU_12601)
Q5PJU3 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T770 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella newport (strain SL254)
B4TJT4 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella heidelberg (strain SL476)
B5REV8 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1A3 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella enteritidis PT4 (strain P125109)
B5FIT8 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella dublin (strain CT_02021853)
Q57JA8 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella choleraesuis (strain SC-B67)
B5F7M0 1.83e-93 270 83 0 156 3 argR Arginine repressor Salmonella agona (strain SL483)
A7MNR4 4.08e-93 269 83 0 156 3 argR Arginine repressor Cronobacter sakazakii (strain ATCC BAA-894)
C0PZQ5 1.22e-92 268 82 0 156 3 argR Arginine repressor Salmonella paratyphi C (strain RKS4594)
Q2NW41 2.24e-92 267 82 0 156 3 argR Arginine repressor Sodalis glossinidius (strain morsitans)
Q6D9D2 3.28e-92 267 82 0 156 3 argR Arginine repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DKH0 3.47e-92 267 82 0 156 3 argR Arginine repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VGW6 5.03e-92 266 83 0 156 3 argR Arginine repressor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4SIU5 1.35e-82 243 77 0 154 3 argR Arginine repressor Aeromonas salmonicida (strain A449)
A0KG11 1.35e-82 243 77 0 154 3 argR Arginine repressor Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LAG9 1.94e-80 237 72 0 154 3 argR Arginine repressor Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7MP98 1.17e-79 235 72 0 153 1 argR Arginine repressor Vibrio vulnificus (strain YJ016)
Q8DEC1 1.17e-79 235 72 0 153 3 argR Arginine repressor Vibrio vulnificus (strain CMCP6)
B7VIC9 1.72e-78 232 71 0 153 3 argR Arginine repressor Vibrio atlanticus (strain LGP32)
Q87SU8 3.01e-78 232 73 0 153 3 argR Arginine repressor Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWD9 3.01e-78 232 73 0 153 3 argR Arginine repressor Vibrio campbellii (strain ATCC BAA-1116)
Q5E876 3.01e-78 232 72 0 153 3 argR Arginine repressor Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KUT4 5.32e-78 231 72 0 153 3 argR Arginine repressor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A8FRT9 2.44e-76 227 70 0 153 3 argR Arginine repressor Shewanella sediminis (strain HAW-EB3)
Q8EIR6 3.99e-76 226 70 0 153 3 argR Arginine repressor Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8H0T9 9.38e-76 225 69 0 153 3 argR Arginine repressor Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CSY8 9.69e-76 225 69 0 153 3 argR Arginine repressor Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TUH7 1.42e-75 225 69 0 153 3 argR Arginine repressor Shewanella halifaxensis (strain HAW-EB4)
A9L341 1.57e-75 225 69 0 153 3 argR Arginine repressor Shewanella baltica (strain OS195)
A6WSM2 1.57e-75 225 69 0 153 3 argR Arginine repressor Shewanella baltica (strain OS185)
A3D074 1.57e-75 225 69 0 153 3 argR Arginine repressor Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EB56 1.57e-75 225 69 0 153 3 argR Arginine repressor Shewanella baltica (strain OS223)
Q0HZ39 1.64e-75 225 69 0 153 3 argR Arginine repressor Shewanella sp. (strain MR-7)
Q0HEW1 1.64e-75 225 69 0 153 3 argR Arginine repressor Shewanella sp. (strain MR-4)
A0L114 1.64e-75 225 69 0 153 3 argR Arginine repressor Shewanella sp. (strain ANA-3)
A3QB90 2.02e-75 224 69 0 153 3 argR Arginine repressor Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8F5K3 2.9e-75 224 72 0 151 3 argR Arginine repressor Glaesserella parasuis serovar 5 (strain SH0165)
B1KGG6 7.44e-75 223 75 0 136 3 argR Arginine repressor Shewanella woodyi (strain ATCC 51908 / MS32)
A1RFX7 9.9e-75 223 69 0 153 3 argR Arginine repressor Shewanella sp. (strain W3-18-1)
A4YAE9 9.9e-75 223 69 0 153 3 argR Arginine repressor Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P57850 1.64e-74 222 70 0 151 3 argR Arginine repressor Pasteurella multocida (strain Pm70)
Q087R5 2.38e-74 222 68 0 153 3 argR Arginine repressor Shewanella frigidimarina (strain NCIMB 400)
A3N1U5 2.4e-74 222 72 0 148 3 argR Arginine repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6LV53 5.47e-74 221 71 0 156 3 argR Arginine repressor Photobacterium profundum (strain SS9)
B3H268 1.69e-73 219 72 0 148 3 argR Arginine repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65T36 3.19e-73 219 68 0 151 3 argR Arginine repressor Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BQM9 2.89e-72 216 71 0 148 3 argR Arginine repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q0I490 1.54e-71 214 67 0 151 3 argR Arginine repressor Histophilus somni (strain 129Pt)
B0UUR7 2.01e-71 214 67 0 151 3 argR Arginine repressor Histophilus somni (strain 2336)
A1SRP6 6.07e-71 213 71 0 145 3 argR Arginine repressor Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
P45110 2.63e-70 211 68 0 149 3 argR Arginine repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VP42 1.5e-69 209 69 0 148 3 argR Arginine repressor Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A5UIX2 2.52e-69 209 67 0 149 3 argR Arginine repressor Haemophilus influenzae (strain PittGG)
A5UCQ2 2.93e-69 209 67 0 149 3 argR Arginine repressor Haemophilus influenzae (strain PittEE)
Q4QL90 3.53e-69 209 67 0 149 3 argR Arginine repressor Haemophilus influenzae (strain 86-028NP)
Q47VK9 1.53e-68 207 66 0 151 3 argR Arginine repressor Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q822Y3 1.12e-21 88 44 4 130 3 argR Arginine repressor Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9Z8Z1 1.88e-20 84 43 5 127 3 argR Arginine repressor Chlamydia pneumoniae
Q254Q1 1.17e-19 82 41 4 124 3 argR Arginine repressor Chlamydia felis (strain Fe/C-56)
A7H7Z8 1.89e-18 80 36 2 136 3 argR Arginine repressor Anaeromyxobacter sp. (strain Fw109-5)
B8D2I6 1.61e-17 77 31 3 140 3 argR Arginine repressor Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B4UCN6 3.69e-17 76 40 4 124 3 argR Arginine repressor Anaeromyxobacter sp. (strain K)
B8JC48 3.77e-17 76 40 4 124 3 argR Arginine repressor Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B1W3B1 1.84e-15 72 33 3 129 3 argR Arginine repressor Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q3AAN4 4.7e-15 70 37 3 120 3 argR Arginine repressor Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B0TEK0 1.23e-14 70 31 4 147 3 argR Arginine repressor Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q2INH7 3.76e-14 68 38 4 126 3 argR Arginine repressor Anaeromyxobacter dehalogenans (strain 2CP-C)
Q9L1A5 5.97e-14 68 30 3 148 1 argR Arginine repressor Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5SI21 1.19e-13 67 31 3 145 3 argR Arginine repressor Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72ID8 1.19e-13 67 31 3 145 3 argR Arginine repressor Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q828A2 1.94e-13 67 30 3 148 3 argR Arginine repressor Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P95721 2.8e-13 67 30 4 148 3 argR Arginine repressor Streptomyces clavuligerus
Q24V09 3.11e-13 66 27 4 143 3 argR Arginine repressor Desulfitobacterium hafniense (strain Y51)
B8FQ41 3.11e-13 66 27 4 143 3 argR Arginine repressor Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B1L9B6 4.69e-13 65 36 3 123 3 argR Arginine repressor Thermotoga sp. (strain RQ2)
A5IK44 4.69e-13 65 36 3 123 3 argR Arginine repressor Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WW19 4.69e-13 65 36 3 123 3 argR Arginine repressor Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5D300 5.45e-13 65 28 4 142 3 argR Arginine repressor Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B1I3J9 7.33e-13 65 32 4 120 3 argR Arginine repressor Desulforudis audaxviator (strain MP104C)
Q6NHG5 1.56e-12 64 31 3 125 3 argR Arginine repressor Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A6L852 2.25e-12 63 29 3 140 3 argR Arginine repressor Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q0AZD9 2.79e-12 63 28 5 142 3 argR Arginine repressor Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8KDE1 6.94e-12 62 28 3 154 3 argR Arginine repressor Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O85175 1.09e-11 62 31 6 147 3 argR Arginine repressor Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QDZ3 1.09e-11 62 31 6 147 3 argR Arginine repressor Corynebacterium glutamicum (strain R)
Q8FTN0 1.31e-11 62 32 5 125 3 argR Arginine repressor Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B3QN92 1.53e-11 61 32 2 125 3 argR Arginine repressor Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q49XW5 1.7e-11 61 28 4 146 3 argR Arginine repressor Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5KXB1 8.05e-11 60 28 3 142 3 argR Arginine repressor Geobacillus kaustophilus (strain HTA426)
Q3ASI3 1.03e-10 59 33 6 128 3 argR Arginine repressor Chlorobium chlorochromatii (strain CaD3)
B3EJ63 1.47e-10 59 31 7 151 3 argR Arginine repressor Chlorobium phaeobacteroides (strain BS1)
A4IQR5 1.64e-10 58 32 4 128 3 argR Arginine repressor Geobacillus thermodenitrificans (strain NG80-2)
P63581 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain MW2)
Q6G945 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain MSSA476)
Q6GGH8 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain MRSA252)
P63580 2.29e-10 58 26 4 146 1 argR Arginine repressor Staphylococcus aureus (strain N315)
P63579 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH66 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain Newman)
Q5HFQ1 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain COL)
Q2YYC1 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IT49 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain JH9)
Q2FY49 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGL3 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain USA300)
A6U1Z2 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain JH1)
A7X2P6 2.29e-10 58 26 4 146 3 argR Arginine repressor Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CP40 2.71e-10 58 27 4 146 3 argR Arginine repressor Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP32 2.71e-10 58 27 4 146 3 argR Arginine repressor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O31408 2.92e-10 58 32 4 128 1 argR Arginine repressor Geobacillus stearothermophilus
Q8A1A4 3.21e-10 58 29 4 146 3 argR Arginine repressor Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A7Z6J3 4.17e-10 58 29 4 143 3 argR Arginine repressor Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B3QWH2 4.31e-10 57 30 6 152 3 argR Arginine repressor Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A8FF09 4.44e-10 57 28 3 142 3 argR Arginine repressor Bacillus pumilus (strain SAFR-032)
O86130 5.08e-10 57 29 4 143 3 argR Arginine repressor Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B3ECP1 5.15e-10 57 30 5 127 3 argR Arginine repressor Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
P57992 7.72e-10 57 31 5 132 3 argR Arginine repressor Mycobacterium leprae (strain TN)
B8ZRK7 7.72e-10 57 31 5 132 3 argR Arginine repressor Mycobacterium leprae (strain Br4923)
Q64YZ2 1.02e-09 57 30 4 133 3 argR Arginine repressor Bacteroides fragilis (strain YCH46)
A1BG28 1.25e-09 56 30 4 132 3 argR Arginine repressor Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5LHY8 1.34e-09 57 30 4 133 3 argR Arginine repressor Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
C5D465 1.44e-09 56 27 3 142 3 argR Arginine repressor Geobacillus sp. (strain WCH70)
P17893 1.62e-09 56 27 4 143 1 argR Arginine repressor Bacillus subtilis (strain 168)
B4S7S0 1.66e-09 56 31 3 122 3 argR Arginine repressor Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A6LU51 1.91e-09 56 30 3 130 3 argR Arginine repressor Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C0MGC7 2.22e-09 55 30 3 121 3 argR Arginine repressor Streptococcus equi subsp. zooepidemicus (strain H70)
A9WQ89 2.51e-09 56 33 6 133 3 argR Arginine repressor Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q9K973 2.62e-09 55 29 4 126 1 argR Arginine repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5X9F2 2.76e-09 55 29 3 121 3 argR2 Arginine repressor Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q67NC2 3.11e-09 55 30 2 115 3 argR Arginine repressor Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A0PP78 3.34e-09 55 33 5 126 3 argR Arginine repressor Mycobacterium ulcerans (strain Agy99)
B2HR31 3.34e-09 55 33 5 126 3 argR Arginine repressor Mycobacterium marinum (strain ATCC BAA-535 / M)
Q9RWC7 3.51e-09 55 30 3 137 3 argR Arginine repressor Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A4J3G5 3.85e-09 55 27 3 140 3 argR Arginine repressor Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C3PGI6 5.34e-09 55 29 4 151 3 argR Arginine repressor Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B4S9U6 5.85e-09 55 27 4 136 3 argR Arginine repressor Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A0QHA9 6.03e-09 55 28 5 151 3 argR Arginine repressor Mycobacterium avium (strain 104)
Q3B424 6.1e-09 55 31 5 128 3 argR Arginine repressor Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P9WPY9 6.48e-09 55 32 5 127 1 argR Arginine repressor Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U314 6.48e-09 55 32 5 127 3 argR Arginine repressor Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANT0 6.48e-09 55 32 5 127 3 argR Arginine repressor Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ74 6.48e-09 55 32 5 127 3 argR Arginine repressor Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A4Y9 6.48e-09 55 32 5 127 3 argR Arginine repressor Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q740I4 6.75e-09 55 28 5 151 3 argR Arginine repressor Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q99XL6 6.98e-09 54 29 3 121 3 argR2 Arginine repressor Streptococcus pyogenes serotype M1
Q8CXE2 7.11e-09 54 30 5 129 3 argR Arginine repressor Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4L6M1 1.23e-08 54 26 4 146 3 argR Arginine repressor Staphylococcus haemolyticus (strain JCSC1435)
P9WPY8 1.26e-08 55 32 5 127 3 argR Arginine repressor Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0CZ71 1.28e-08 53 29 3 121 3 argR2 Arginine repressor Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ70 1.28e-08 53 29 3 121 3 argR2 Arginine repressor Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5YYF4 2.44e-08 53 35 5 125 3 argR Arginine repressor Nocardia farcinica (strain IFM 10152)
A1A1W8 3.56e-08 53 28 4 144 3 argR Arginine repressor Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
C1CYD7 3.76e-08 52 33 4 144 3 argR Arginine repressor Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q2RIC2 4.42e-08 52 28 3 125 3 argR Arginine repressor Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B9DNS1 5.13e-08 52 26 5 147 3 argR Arginine repressor Staphylococcus carnosus (strain TM300)
B3DSY8 6.28e-08 52 28 3 143 3 argR Arginine repressor Bifidobacterium longum (strain DJO10A)
Q8G5F1 6.61e-08 52 28 3 143 3 argR Arginine repressor Bifidobacterium longum (strain NCC 2705)
Q1IIY8 8.76e-08 51 28 3 118 3 argR Arginine repressor Koribacter versatilis (strain Ellin345)
B7GTP1 8.8e-08 52 28 3 143 3 argR Arginine repressor Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
C0ZC13 9.98e-08 51 25 4 143 3 argR Arginine repressor Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A6KXY8 1.55e-07 51 29 4 143 3 argR Arginine repressor Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q97HD8 2.15e-07 50 31 4 111 3 argR Arginine repressor Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9VGC9 2.58e-07 50 26 3 142 3 argR Arginine repressor Bacillus mycoides (strain KBAB4)
Q5WF65 2.71e-07 50 28 4 123 3 argR Arginine repressor Shouchella clausii (strain KSM-K16)
Q818S1 2.74e-07 50 26 3 142 3 argR2 Arginine repressor Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q635A9 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus cereus (strain ZK / E33L)
B9IXG8 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus cereus (strain Q1)
B7HNT8 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus cereus (strain AH187)
C1ERP8 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus cereus (strain 03BB102)
Q81M56 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus anthracis
C3LJU9 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7V4 3.23e-07 50 26 3 142 3 argR Arginine repressor Bacillus anthracis (strain A0248)
Q6HDZ0 3.23e-07 50 26 3 142 3 argR2 Arginine repressor Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q731B9 3.23e-07 50 26 3 142 3 argR2 Arginine repressor Bacillus cereus (strain ATCC 10987 / NRS 248)
B9E6Q4 3.35e-07 50 23 3 142 3 argR Arginine repressor Macrococcus caseolyticus (strain JCSC5402)
B1YLQ7 3.54e-07 50 25 5 155 3 argR Arginine repressor Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q024T4 1.03e-06 48 28 4 139 3 argR Arginine repressor Solibacter usitatus (strain Ellin6076)
Q73E88 3.45e-06 47 27 5 152 3 argR1 Arginine regulator Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HP30 4.14e-06 47 27 5 152 3 argR1 Arginine regulator Bacillus thuringiensis subsp. konkukian (strain 97-27)
C4Z0G8 7.02e-06 46 30 4 113 3 argR Arginine repressor Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q81II2 1.06e-05 46 27 5 152 3 argR1 Arginine regulator Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A3DDM1 3.24e-05 45 29 4 120 3 argR Arginine repressor Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A4XKP7 5.62e-05 44 28 4 144 3 argR Arginine repressor Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B0K9E8 5.96e-05 44 28 5 125 3 argR Arginine repressor Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
P58685 7.27e-05 43 29 3 140 3 argR2 Arginine repressor Clostridium perfringens (strain 13 / Type A)
B0K0V5 0.000113 43 28 5 125 3 argR Arginine repressor Thermoanaerobacter sp. (strain X514)
B2V4R0 0.000164 42 25 3 119 3 argR Arginine repressor Clostridium botulinum (strain Alaska E43 / Type E3)
A8MFI5 0.000193 42 29 4 119 3 argR Arginine repressor Alkaliphilus oremlandii (strain OhILAs)
A7GEJ0 0.000225 42 26 5 122 3 argR Arginine repressor Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IMN1 0.000225 42 26 5 122 3 argR Arginine repressor Clostridium botulinum (strain Okra / Type B1)
B8I3A2 0.000269 42 23 5 146 3 argR Arginine repressor Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B2TRM1 0.000316 42 24 3 119 3 argR Arginine repressor Clostridium botulinum (strain Eklund 17B / Type B)
C1F4F3 0.000331 42 26 4 126 3 argR Arginine repressor Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q8RAC2 0.001 40 30 5 125 3 argR Arginine repressor Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16920
Feature type CDS
Gene argR
Product transcriptional regulator ArgR
Location 3727394 - 3727864 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1388
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01316 Arginine repressor, DNA binding domain
PF02863 Arginine repressor, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1438 Transcription (K) K Arginine repressor

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03402 transcriptional regulator of arginine metabolism - -

Protein Sequence

MRTPSKQEDLVKAFKALLKEEKFSSQGEIVTALQEAGFDNINQSKISRMLTKFGAVRTRNAKMEMVYCLPTELGVPTASSPLKNLVLDIDHNHSVVVIRTSPGAAQLIARLLDSLGKAEGILGSIAGDDTIFSTPAPGFSTEELRDAILNLFDQEL

Flanking regions ( +/- flanking 50bp)

CACTTCTCTGCATAATGTGCGAGTTATTGATAACTCACTAAAGGTGAACTATGCGCACTCCTTCTAAGCAAGAAGACTTGGTTAAAGCATTTAAAGCCCTGCTGAAAGAAGAAAAATTCAGTTCACAAGGCGAGATTGTAACTGCATTACAAGAAGCTGGTTTTGATAATATTAACCAGTCTAAAATCTCTCGTATGCTAACAAAATTTGGCGCAGTAAGAACGCGTAATGCCAAAATGGAGATGGTTTACTGCCTGCCAACAGAACTTGGTGTACCAACAGCAAGTAGCCCATTGAAAAATTTGGTACTTGATATTGACCATAACCACTCAGTAGTGGTTATTAGAACCAGCCCCGGTGCCGCACAGCTTATTGCACGTTTATTAGATTCTTTAGGTAAAGCAGAAGGGATCCTCGGAAGTATCGCTGGTGATGACACTATTTTTTCTACACCCGCGCCAGGATTCTCAACAGAAGAACTACGAGATGCGATTTTAAACCTATTTGATCAGGAATTATAAATAGCGACTTCAGGAAAATAGGTCATAAACAGTAAGCCACTGAAATTTCA