Homologs in group_1431

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08505 FBDBKF_08505 89.9 Morganella morganii S1 rplI 50S ribosomal protein L9
EHELCC_13020 EHELCC_13020 89.9 Morganella morganii S2 rplI 50S ribosomal protein L9
NLDBIP_13360 NLDBIP_13360 89.9 Morganella morganii S4 rplI 50S ribosomal protein L9
LHKJJB_13195 LHKJJB_13195 89.9 Morganella morganii S3 rplI 50S ribosomal protein L9
HKOGLL_11835 HKOGLL_11835 89.9 Morganella morganii S5 rplI 50S ribosomal protein L9
F4V73_RS09730 F4V73_RS09730 89.3 Morganella psychrotolerans rplI 50S ribosomal protein L9

Distribution of the homologs in the orthogroup group_1431

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1431

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F278 7.42e-105 298 100 0 149 3 rplI Large ribosomal subunit protein bL9 Proteus mirabilis (strain HI4320)
A1JIT1 9.35e-93 268 87 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8G8W7 2.08e-92 267 85 0 149 3 rplI Large ribosomal subunit protein bL9 Serratia proteamaculans (strain 568)
B1JMM1 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F99 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRM3 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pestis (strain Pestoides F)
Q1CEH3 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYL3 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB84 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pestis
B2K2L6 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBW7 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMW2 4.25e-92 266 86 0 149 3 rplI Large ribosomal subunit protein bL9 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5BF79 1.16e-91 265 85 0 149 3 rplI Large ribosomal subunit protein bL9 Edwardsiella ictaluri (strain 93-146)
Q7MYU9 1.64e-91 265 87 0 149 3 rplI Large ribosomal subunit protein bL9 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D138 1.38e-90 262 85 0 149 3 rplI Large ribosomal subunit protein bL9 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MM80 1.53e-90 262 85 0 149 3 rplI Large ribosomal subunit protein bL9 Cronobacter sakazakii (strain ATCC BAA-894)
A8AMJ4 7.13e-89 258 84 0 149 3 rplI Large ribosomal subunit protein bL9 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YUE4 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Shigella sonnei (strain Ss046)
P0A7R4 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Shigella flexneri
Q0SX83 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Shigella flexneri serotype 5b (strain 8401)
Q31TD4 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Shigella boydii serotype 4 (strain Sb227)
B2TY76 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLY5 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R357 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain UTI89 / UPEC)
B1LR79 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain SMS-3-5 / SECEC)
B6I2A9 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain SE11)
B7NGD7 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7R1 1.98e-88 257 85 0 149 1 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain K12)
B1IT03 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7R2 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9J0 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJA7 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O1:K1 / APEC
A8A7U9 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O9:H4 (strain HS)
B1XDV3 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain K12 / DH10B)
C4ZR80 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9G5 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O8 (strain IAI1)
B7MT77 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O81 (strain ED1a)
B7NTQ8 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2K8 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7R3 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O157:H7
B7LCR4 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli (strain 55989 / EAEC)
B7MLK8 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQL2 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV74 1.98e-88 257 85 0 149 3 rplI Large ribosomal subunit protein bL9 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q328J6 3.7e-88 256 85 0 149 1 rplI Large ribosomal subunit protein bL9 Shigella dysenteriae serotype 1 (strain Sd197)
B2VCV8 5.26e-88 256 83 0 149 3 rplI Large ribosomal subunit protein bL9 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DE12 4.82e-87 253 87 0 149 3 rplI Large ribosomal subunit protein bL9 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8Z163 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella typhi
B4TT36 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella schwarzengrund (strain CVM19633)
B5BKL2 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella paratyphi A (strain AKU_12601)
C0Q6G1 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella paratyphi C (strain RKS4594)
Q5PJ55 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57GI8 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella choleraesuis (strain SC-B67)
A9MF07 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F3C0 1.78e-86 252 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella agona (strain SL483)
B5Y305 5.15e-86 251 81 0 149 3 rplI Large ribosomal subunit protein bL9 Klebsiella pneumoniae (strain 342)
A6THB4 5.56e-86 251 81 0 149 3 rplI Large ribosomal subunit protein bL9 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8ZK80 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N521 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3F4 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella newport (strain SL254)
B4TFD8 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella heidelberg (strain SL476)
B5R9F1 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0S1 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella enteritidis PT4 (strain P125109)
B5FSA4 9.41e-86 250 81 0 149 3 rplI Large ribosomal subunit protein bL9 Salmonella dublin (strain CT_02021853)
A4W5T2 4.52e-81 238 82 0 149 3 rplI Large ribosomal subunit protein bL9 Enterobacter sp. (strain 638)
Q2NW52 6.15e-79 233 82 0 149 3 rplI Large ribosomal subunit protein bL9 Sodalis glossinidius (strain morsitans)
Q7MH91 3.51e-78 231 75 0 149 3 rplI Large ribosomal subunit protein bL9 Vibrio vulnificus (strain YJ016)
Q8DCL3 3.51e-78 231 75 0 149 3 rplI Large ribosomal subunit protein bL9 Vibrio vulnificus (strain CMCP6)
A6VMD3 1.9e-77 229 75 0 149 3 rplI Large ribosomal subunit protein bL9 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q87L75 1.32e-76 227 75 0 148 3 rplI Large ribosomal subunit protein bL9 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MSX5 2.45e-76 226 73 0 148 3 rplI Large ribosomal subunit protein bL9 Vibrio campbellii (strain ATCC BAA-1116)
Q6LM44 4.05e-75 223 72 0 148 3 rplI Large ribosomal subunit protein bL9 Photobacterium profundum (strain SS9)
B5FBQ0 7.08e-75 223 75 1 148 3 rplI Large ribosomal subunit protein bL9 Aliivibrio fischeri (strain MJ11)
Q5E2E1 7.08e-75 223 75 1 148 3 rplI Large ribosomal subunit protein bL9 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0US46 5.62e-74 220 70 0 149 3 rplI Large ribosomal subunit protein bL9 Histophilus somni (strain 2336)
Q0I4E8 5.62e-74 220 70 0 149 3 rplI Large ribosomal subunit protein bL9 Histophilus somni (strain 129Pt)
C3LRA1 1.49e-73 219 71 0 149 3 rplI Large ribosomal subunit protein bL9 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUY9 1.49e-73 219 71 0 149 3 rplI Large ribosomal subunit protein bL9 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3I8 1.49e-73 219 71 0 149 3 rplI Large ribosomal subunit protein bL9 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B4S010 2.85e-73 219 70 0 149 3 rplI Large ribosomal subunit protein bL9 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B7VI67 3.91e-73 218 72 0 148 3 rplI Large ribosomal subunit protein bL9 Vibrio atlanticus (strain LGP32)
Q1LSR5 2.24e-72 216 69 0 149 3 rplI Large ribosomal subunit protein bL9 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q4QN04 3.62e-71 213 75 0 149 3 rplI Large ribosomal subunit protein bL9 Haemophilus influenzae (strain 86-028NP)
Q3II82 1.5e-70 212 69 0 149 3 rplI Large ribosomal subunit protein bL9 Pseudoalteromonas translucida (strain TAC 125)
A5UH49 1.7e-70 211 75 0 149 3 rplI Large ribosomal subunit protein bL9 Haemophilus influenzae (strain PittGG)
P44349 2.02e-70 211 75 0 149 3 rplI Large ribosomal subunit protein bL9 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5U9V1 2.02e-70 211 75 0 149 3 rplI Large ribosomal subunit protein bL9 Haemophilus influenzae (strain PittEE)
Q489T8 1.41e-69 209 67 0 149 3 rplI Large ribosomal subunit protein bL9 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9CLP0 2.71e-69 208 77 0 149 3 rplI Large ribosomal subunit protein bL9 Pasteurella multocida (strain Pm70)
B1KHY7 7.76e-69 207 71 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FR98 3.56e-68 206 70 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella sediminis (strain HAW-EB3)
A3QI49 1.96e-66 201 67 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65VD1 2.3e-64 196 74 0 149 3 rplI Large ribosomal subunit protein bL9 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2SLB3 6.74e-64 195 65 1 149 3 rplI Large ribosomal subunit protein bL9 Hahella chejuensis (strain KCTC 2396)
B6EMP3 1.47e-63 194 72 1 148 3 rplI Large ribosomal subunit protein bL9 Aliivibrio salmonicida (strain LFI1238)
Q8EAH5 1.89e-63 194 72 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5QY04 2.74e-63 193 69 0 147 3 rplI Large ribosomal subunit protein bL9 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q07XT0 6.72e-63 192 71 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella frigidimarina (strain NCIMB 400)
A1RNI6 1.54e-62 191 73 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella sp. (strain W3-18-1)
A4Y3F3 1.54e-62 191 73 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H8K9 8.71e-62 189 71 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUU6 1.01e-61 189 71 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella halifaxensis (strain HAW-EB4)
Q15PE2 1.92e-61 189 70 0 149 3 rplI Large ribosomal subunit protein bL9 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7VMD5 3e-61 188 66 0 149 3 rplI Large ribosomal subunit protein bL9 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4LAB6 6.53e-61 187 71 0 135 3 rplI Large ribosomal subunit protein bL9 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C1DLR5 1.26e-60 186 59 1 147 3 rplI Large ribosomal subunit protein bL9 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q12RW6 2.3e-60 186 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HYW3 2.96e-60 186 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella sp. (strain MR-7)
Q0HF42 2.96e-60 186 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella sp. (strain MR-4)
A0KT23 2.96e-60 186 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella sp. (strain ANA-3)
A1SA57 3.49e-60 185 72 0 137 3 rplI Large ribosomal subunit protein bL9 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0V7G5 2.4e-59 183 61 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain AYE)
A3M6Q6 2.4e-59 183 61 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HUA4 2.4e-59 183 61 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain ACICU)
B7IBC3 2.4e-59 183 61 1 149 1 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain AB0057)
B7H0J8 2.4e-59 183 61 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain AB307-0294)
B0VM08 5.33e-59 182 60 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baumannii (strain SDF)
C4K4M9 5.56e-59 182 59 0 149 3 rplI Large ribosomal subunit protein bL9 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A9L123 7.89e-59 182 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella baltica (strain OS195)
A6WJ82 7.89e-59 182 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella baltica (strain OS185)
B8E9N9 7.89e-59 182 74 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella baltica (strain OS223)
B8CIQ4 1.11e-58 182 72 0 149 3 rplI Large ribosomal subunit protein bL9 Shewanella piezotolerans (strain WP3 / JCM 13877)
A4SIZ9 1.54e-58 181 71 1 148 3 rplI Large ribosomal subunit protein bL9 Aeromonas salmonicida (strain A449)
A0KG69 2.72e-58 181 70 1 148 3 rplI Large ribosomal subunit protein bL9 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3D8Q2 2.78e-58 181 73 0 136 3 rplI Large ribosomal subunit protein bL9 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A4XQ00 4.81e-58 180 62 1 148 3 rplI Large ribosomal subunit protein bL9 Pseudomonas mendocina (strain ymp)
Q6F9Q8 6.54e-58 179 59 1 149 3 rplI Large ribosomal subunit protein bL9 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B3PCS0 1.36e-57 179 64 1 137 3 rplI Large ribosomal subunit protein bL9 Cellvibrio japonicus (strain Ueda107)
A4VQM7 4.32e-56 175 64 1 148 3 rplI Large ribosomal subunit protein bL9 Stutzerimonas stutzeri (strain A1501)
Q0AB47 9.28e-56 174 59 1 146 3 rplI Large ribosomal subunit protein bL9 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3JEJ4 1.2e-54 171 57 0 149 3 rplI Large ribosomal subunit protein bL9 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q48NZ0 1.13e-53 169 64 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZYW8 4.26e-53 167 64 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas syringae pv. syringae (strain B728a)
Q87VK6 4.26e-53 167 64 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C1DCR1 4.59e-53 167 56 1 149 3 rplI Large ribosomal subunit protein bL9 Laribacter hongkongensis (strain HLHK9)
B0KKY0 5.18e-53 167 59 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas putida (strain GB-1)
B1JAG8 6.96e-53 167 59 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas putida (strain W619)
Q7NRZ0 1.14e-52 166 55 1 149 3 rplI Large ribosomal subunit protein bL9 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1I464 1.88e-52 166 61 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas entomophila (strain L48)
Q5WWL7 9.29e-52 164 55 1 148 3 rplI Large ribosomal subunit protein bL9 Legionella pneumophila (strain Lens)
Q4KJ59 1.03e-51 164 63 1 136 3 rplI Large ribosomal subunit protein bL9 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5ZV51 1.38e-51 164 55 1 147 3 rplI Large ribosomal subunit protein bL9 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IC87 1.38e-51 164 55 1 147 3 rplI Large ribosomal subunit protein bL9 Legionella pneumophila (strain Corby)
Q88DF1 2.18e-51 163 60 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9R5 2.18e-51 163 60 1 137 3 rplI Large ribosomal subunit protein bL9 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q493V3 2.19e-51 163 54 2 151 3 rplI Large ribosomal subunit protein bL9 Blochmanniella pennsylvanica (strain BPEN)
Q5X4X3 2.35e-51 163 54 1 148 3 rplI Large ribosomal subunit protein bL9 Legionella pneumophila (strain Paris)
Q3KIX5 2.69e-51 163 62 1 136 3 rplI Large ribosomal subunit protein bL9 Pseudomonas fluorescens (strain Pf0-1)
B8F5T4 8.74e-51 162 65 0 149 3 rplI Large ribosomal subunit protein bL9 Glaesserella parasuis serovar 5 (strain SH0165)
B8GNS5 4.8e-50 160 64 0 140 3 rplI Large ribosomal subunit protein bL9 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1T041 6.31e-50 159 68 0 138 3 rplI Large ribosomal subunit protein bL9 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0VMG2 8.39e-50 159 53 2 148 3 rplI Large ribosomal subunit protein bL9 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q9HUN2 9.39e-50 159 64 1 149 1 rplI Large ribosomal subunit protein bL9 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02F86 9.39e-50 159 64 1 149 3 rplI Large ribosomal subunit protein bL9 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1Z5 9.39e-50 159 64 1 149 3 rplI Large ribosomal subunit protein bL9 Pseudomonas aeruginosa (strain LESB58)
A6VD45 9.39e-50 159 64 1 149 3 rplI Large ribosomal subunit protein bL9 Pseudomonas aeruginosa (strain PA7)
Q8K920 1.65e-49 158 54 0 138 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5WFZ1 1.94e-49 159 58 1 149 3 rplI Large ribosomal subunit protein bL9 Psychrobacter sp. (strain PRwf-1)
C3KE70 2.23e-49 158 63 1 136 3 rplI Large ribosomal subunit protein bL9 Pseudomonas fluorescens (strain SBW25)
Q1QZ60 3.16e-49 157 56 1 149 3 rplI Large ribosomal subunit protein bL9 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8D883 6.34e-49 157 51 0 149 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57625 6.34e-49 157 51 0 149 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8C6 6.34e-49 157 51 0 149 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C5BN48 1.81e-48 155 55 0 149 3 rplI Large ribosomal subunit protein bL9 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1U390 2.07e-48 155 60 1 149 3 rplI Large ribosomal subunit protein bL9 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5H053 7.42e-48 154 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIV2 7.42e-48 154 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P330 7.42e-48 154 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q21LV8 7.71e-48 154 58 0 135 3 rplI Large ribosomal subunit protein bL9 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3SH34 9.03e-48 154 53 1 149 3 rplI Large ribosomal subunit protein bL9 Thiobacillus denitrificans (strain ATCC 25259)
Q3BV19 1.28e-47 154 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PM12 1.28e-47 154 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas axonopodis pv. citri (strain 306)
A1K3D3 1.36e-47 154 53 1 149 3 rplI Large ribosomal subunit protein bL9 Azoarcus sp. (strain BH72)
B0BQB0 2.42e-47 153 69 0 137 3 rplI Large ribosomal subunit protein bL9 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q8PAC0 2.61e-47 153 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RUY7 2.61e-47 153 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas campestris pv. campestris (strain B100)
Q4UTA5 2.61e-47 153 54 1 146 3 rplI Large ribosomal subunit protein bL9 Xanthomonas campestris pv. campestris (strain 8004)
A3N1H1 6.6e-47 152 69 0 137 3 rplI Large ribosomal subunit protein bL9 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q31FW7 9.04e-47 151 57 1 144 3 rplI Large ribosomal subunit protein bL9 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B1XXH2 1.27e-46 151 53 1 149 3 rplI Large ribosomal subunit protein bL9 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q5P2M2 2.34e-46 150 53 1 149 3 rplI Large ribosomal subunit protein bL9 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1H1P0 3.84e-46 150 55 1 149 3 rplI Large ribosomal subunit protein bL9 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B0U081 1.24e-45 149 54 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q9PAF9 3.92e-45 147 52 1 146 3 rplI Large ribosomal subunit protein bL9 Xylella fastidiosa (strain 9a5c)
B4SP92 4.87e-45 147 56 1 137 3 rplI Large ribosomal subunit protein bL9 Stenotrophomonas maltophilia (strain R551-3)
Q87A85 4.93e-45 147 52 1 146 3 rplI Large ribosomal subunit protein bL9 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5H0 4.93e-45 147 52 1 146 3 rplI Large ribosomal subunit protein bL9 Xylella fastidiosa (strain M12)
B2I9S7 4.93e-45 147 52 1 146 3 rplI Large ribosomal subunit protein bL9 Xylella fastidiosa (strain M23)
B2FKJ7 1.44e-44 146 56 1 137 3 rplI Large ribosomal subunit protein bL9 Stenotrophomonas maltophilia (strain K279a)
A5EXM9 2.43e-44 145 50 2 150 3 rplI Large ribosomal subunit protein bL9 Dichelobacter nodosus (strain VCS1703A)
Q606I1 4.11e-44 145 58 1 149 3 rplI Large ribosomal subunit protein bL9 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WUS4 7.8e-44 144 49 1 146 3 rplI Large ribosomal subunit protein bL9 Halorhodospira halophila (strain DSM 244 / SL1)
Q1QBZ2 3.8e-43 143 56 1 149 3 rplI Large ribosomal subunit protein bL9 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B2JG21 3.84e-43 142 54 1 135 3 rplI Large ribosomal subunit protein bL9 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A9LZQ0 7.31e-43 142 56 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria meningitidis serogroup C (strain 053442)
A4G709 8.8e-43 141 51 1 149 3 rplI Large ribosomal subunit protein bL9 Herminiimonas arsenicoxydans
B4RMH7 1.16e-42 141 55 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria gonorrhoeae (strain NCCP11945)
Q5F922 1.16e-42 141 55 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2Y7M8 1.78e-42 140 53 1 149 3 rplI Large ribosomal subunit protein bL9 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A4IY05 2.45e-42 140 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NG01 2.45e-42 140 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SGH2 2.45e-42 140 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14HF3 2.45e-42 140 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. tularensis (strain FSC 198)
A9AJW4 2.59e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BEQ9 2.71e-42 140 49 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRJ1 2.71e-42 140 49 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia ambifaria (strain MC40-6)
Q4FS19 2.86e-42 140 55 1 149 3 rplI Large ribosomal subunit protein bL9 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q39FK1 3.05e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9JZ31 3.48e-42 140 55 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1BH33 4.1e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia orbicola (strain AU 1054)
B1JTF0 4.1e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia orbicola (strain MC0-3)
B4EBH0 4.1e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K7Z5 4.1e-42 140 48 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia cenocepacia (strain HI2424)
Q9JU26 5.94e-42 139 54 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A0Q6H2 5.99e-42 139 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. novicida (strain U112)
A1KUE7 1.62e-41 138 54 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q0ADI9 2.08e-41 138 50 1 149 3 rplI Large ribosomal subunit protein bL9 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2A3H5 2.17e-41 138 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. holarctica (strain LVS)
A7NC56 2.17e-41 138 50 3 153 3 rplI Large ribosomal subunit protein bL9 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4JEU8 6.84e-41 137 47 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9BNG0 9.91e-41 136 49 1 149 3 rplI Large ribosomal subunit protein bL9 Delftia acidovorans (strain DSM 14801 / SPH-1)
A6W0Y6 1.8e-40 135 56 2 149 3 rplI Large ribosomal subunit protein bL9 Marinomonas sp. (strain MWYL1)
Q7VQN7 4.87e-40 135 45 2 149 3 rplI Large ribosomal subunit protein bL9 Blochmanniella floridana
O07816 5.87e-40 134 54 1 148 3 rplI Large ribosomal subunit protein bL9 Neisseria gonorrhoeae
Q8XZT5 1.45e-39 133 56 1 135 3 rplI Large ribosomal subunit protein bL9 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7W7P5 1.72e-39 133 52 2 136 3 rplI Large ribosomal subunit protein bL9 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL32 1.72e-39 133 52 2 136 3 rplI Large ribosomal subunit protein bL9 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2UAG7 2.01e-39 133 54 1 146 3 rplI Large ribosomal subunit protein bL9 Ralstonia pickettii (strain 12J)
Q82XQ9 2.29e-39 133 51 1 149 3 rplI Large ribosomal subunit protein bL9 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q47GQ6 3.27e-39 132 55 1 149 3 rplI Large ribosomal subunit protein bL9 Dechloromonas aromatica (strain RCB)
Q89A42 3.58e-39 132 45 1 150 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VV92 5.06e-39 132 52 2 136 3 rplI Large ribosomal subunit protein bL9 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q13ZG9 5.79e-39 132 50 1 149 3 rplI Large ribosomal subunit protein bL9 Paraburkholderia xenovorans (strain LB400)
Q128U4 6.46e-39 132 48 1 149 3 rplI Large ribosomal subunit protein bL9 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1WGK4 1.14e-38 131 48 1 137 3 rplI Large ribosomal subunit protein bL9 Verminephrobacter eiseniae (strain EF01-2)
Q8D2U4 2.58e-38 130 42 0 146 3 rplI Large ribosomal subunit protein bL9 Wigglesworthia glossinidia brevipalpis
Q2KZ23 6.14e-38 129 49 2 137 3 rplI Large ribosomal subunit protein bL9 Bordetella avium (strain 197N)
A3NAB3 2.02e-37 128 50 1 149 3 rplI Large ribosomal subunit protein bL9 Burkholderia pseudomallei (strain 668)
A6SXJ7 4.48e-37 127 51 1 135 3 rplI Large ribosomal subunit protein bL9 Janthinobacterium sp. (strain Marseille)
A4SVX9 7.15e-37 126 55 1 149 3 rplI Large ribosomal subunit protein bL9 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A2SG02 1.12e-36 126 52 1 135 3 rplI Large ribosomal subunit protein bL9 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B1XTM8 1.67e-36 125 55 1 149 3 rplI Large ribosomal subunit protein bL9 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A9KFL8 2.25e-36 125 53 1 149 3 rplI Large ribosomal subunit protein bL9 Coxiella burnetii (strain Dugway 5J108-111)
Q83D73 4.06e-36 124 53 1 149 1 rplI Large ribosomal subunit protein bL9 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND50 4.06e-36 124 53 1 149 3 rplI Large ribosomal subunit protein bL9 Coxiella burnetii (strain RSA 331 / Henzerling II)
A8LQQ7 8.96e-36 125 47 3 151 3 rplI Large ribosomal subunit protein bL9 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A1AWV1 1.04e-35 123 44 3 147 3 rplI Large ribosomal subunit protein bL9 Ruthia magnifica subsp. Calyptogena magnifica
Q21WD3 1.35e-35 123 45 1 149 3 rplI Large ribosomal subunit protein bL9 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1LLX1 4.29e-35 122 51 1 135 3 rplI Large ribosomal subunit protein bL9 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q164N5 9.27e-35 123 47 2 144 3 rplI Large ribosomal subunit protein bL9 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B2T3N6 1.62e-34 120 52 1 135 3 rplI Large ribosomal subunit protein bL9 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1WAR1 1.64e-34 120 50 1 149 3 rplI Large ribosomal subunit protein bL9 Acidovorax sp. (strain JS42)
B9MDJ2 1.64e-34 120 50 1 149 3 rplI Large ribosomal subunit protein bL9 Acidovorax ebreus (strain TPSY)
Q63UY3 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia pseudomallei (strain K96243)
Q3JRJ5 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia pseudomallei (strain 1710b)
A3NW31 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia pseudomallei (strain 1106a)
A1V4Q8 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia mallei (strain SAVP1)
Q62JR2 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia mallei (strain ATCC 23344)
A2S245 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia mallei (strain NCTC 10229)
A3MKD3 3.7e-34 119 53 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia mallei (strain NCTC 10247)
A5CWE1 4.22e-34 119 41 2 148 3 rplI Large ribosomal subunit protein bL9 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B5EP97 4.39e-34 119 46 2 149 3 rplI Large ribosomal subunit protein bL9 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J913 4.39e-34 119 46 2 149 3 rplI Large ribosomal subunit protein bL9 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q056Y0 5.27e-34 119 38 0 149 3 rplI Large ribosomal subunit protein bL9 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q2SWJ6 6.31e-34 119 52 1 135 3 rplI Large ribosomal subunit protein bL9 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4WS83 6.35e-34 120 49 2 138 3 rplI Large ribosomal subunit protein bL9 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q0K9E8 7.85e-34 119 54 1 135 3 rplI Large ribosomal subunit protein bL9 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1TLI4 1.46e-33 118 51 1 137 3 rplI Large ribosomal subunit protein bL9 Paracidovorax citrulli (strain AAC00-1)
B3R2P4 1.72e-33 118 54 1 135 3 rplI Large ribosomal subunit protein bL9 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A1VPX1 1.74e-33 118 51 1 135 3 rplI Large ribosomal subunit protein bL9 Polaromonas naphthalenivorans (strain CJ2)
A0LAG5 3.24e-33 117 46 3 140 3 rplI Large ribosomal subunit protein bL9 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q57ER5 3.37e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella abortus biovar 1 (strain 9-941)
Q2YMH2 3.37e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella abortus (strain 2308)
B2S9V1 3.37e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella abortus (strain S19)
Q8G276 3.63e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella suis biovar 1 (strain 1330)
B0CKD6 3.63e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YFN7 3.63e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHF9 3.63e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8X5 3.63e-33 118 43 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
C5CUP3 6.2e-33 116 49 1 135 3 rplI Large ribosomal subunit protein bL9 Variovorax paradoxus (strain S110)
A5VP24 7.03e-33 117 44 2 138 3 rplI Large ribosomal subunit protein bL9 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q3J1L9 9.74e-33 117 45 2 144 3 rplI Large ribosomal subunit protein bL9 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PKL7 9.74e-33 117 45 2 144 3 rplI Large ribosomal subunit protein bL9 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9KJP2 1.02e-32 117 45 2 144 3 rplI Large ribosomal subunit protein bL9 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A6WWE3 1.12e-32 117 41 2 146 3 rplI Large ribosomal subunit protein bL9 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6G449 1.89e-32 117 42 3 146 3 rplI Large ribosomal subunit protein bL9 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5LR48 2.63e-32 116 45 2 146 3 rplI Large ribosomal subunit protein bL9 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GHU0 2.74e-32 116 47 4 148 3 rplI Large ribosomal subunit protein bL9 Ruegeria sp. (strain TM1040)
Q46ZR6 2.9e-32 115 54 1 135 3 rplI Large ribosomal subunit protein bL9 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B8DRL4 3.8e-32 115 43 2 149 3 rplI Large ribosomal subunit protein bL9 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A9IT92 5.2e-32 114 49 2 137 3 rplI Large ribosomal subunit protein bL9 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2W5H3 6.14e-32 115 44 2 138 3 rplI Large ribosomal subunit protein bL9 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B8J3A8 2.12e-31 113 40 2 149 3 rplI Large ribosomal subunit protein bL9 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A9H1M3 2.49e-31 113 44 2 138 3 rplI Large ribosomal subunit protein bL9 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q2RXC9 2.68e-31 114 42 2 137 3 rplI Large ribosomal subunit protein bL9 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6ABX0 2.69e-31 112 45 5 151 3 rplI Large ribosomal subunit protein bL9 Leifsonia xyli subsp. xyli (strain CTCB07)
A7IK08 3.1e-31 113 45 2 138 3 rplI Large ribosomal subunit protein bL9 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A1B0F6 3.11e-31 113 45 3 151 3 rplI Large ribosomal subunit protein bL9 Paracoccus denitrificans (strain Pd 1222)
Q8R6M7 4.4e-31 112 38 2 149 3 rplI Large ribosomal subunit protein bL9 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1US53 4.92e-31 112 41 2 138 3 rplI Large ribosomal subunit protein bL9 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A9IRT7 5.93e-31 113 40 3 146 3 rplI Large ribosomal subunit protein bL9 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q312D7 7.81e-31 112 41 2 149 3 rplI Large ribosomal subunit protein bL9 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B8ESI1 2.2e-30 111 42 2 144 3 rplI Large ribosomal subunit protein bL9 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A7HYI4 2.24e-30 111 43 2 144 3 rplI Large ribosomal subunit protein bL9 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q6G063 2.34e-30 111 39 3 146 3 rplI Large ribosomal subunit protein bL9 Bartonella quintana (strain Toulouse)
B8GVN4 2.45e-30 111 42 2 138 3 rplI Large ribosomal subunit protein bL9 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Q3 2.45e-30 111 42 2 138 3 rplI Large ribosomal subunit protein bL9 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O68128 2.9e-30 110 47 2 144 3 rplI Large ribosomal subunit protein bL9 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q1D289 5.65e-30 108 38 2 149 3 rplI Large ribosomal subunit protein bL9 Myxococcus xanthus (strain DK1622)
B2IHD4 8.98e-30 109 42 2 146 3 rplI Large ribosomal subunit protein bL9 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q0BPY8 1.01e-29 109 40 2 144 3 rplI Large ribosomal subunit protein bL9 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B6IN81 1.01e-29 109 38 2 144 3 rplI Large ribosomal subunit protein bL9 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q1MRG7 1.12e-29 108 40 2 149 3 rplI Large ribosomal subunit protein bL9 Lawsonia intracellularis (strain PHE/MN1-00)
Q39RR5 1.12e-29 108 40 2 146 3 rplI Large ribosomal subunit protein bL9 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3QRL8 1.59e-29 108 40 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q5FU59 2.31e-29 108 44 2 142 3 rplI Large ribosomal subunit protein bL9 Gluconobacter oxydans (strain 621H)
A9W8G1 3.52e-29 108 41 2 146 3 rplI Large ribosomal subunit protein bL9 Methylorubrum extorquens (strain PA1)
B7L2N9 3.52e-29 108 41 2 146 3 rplI Large ribosomal subunit protein bL9 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q74FE1 3.76e-29 107 41 2 146 3 rplI Large ribosomal subunit protein bL9 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C1A7N5 3.82e-29 107 41 2 149 3 rplI Large ribosomal subunit protein bL9 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B1ZFQ5 3.83e-29 108 41 2 146 3 rplI Large ribosomal subunit protein bL9 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A5FYN6 4.16e-29 107 42 3 146 3 rplI Large ribosomal subunit protein bL9 Acidiphilium cryptum (strain JF-5)
Q984U0 4.53e-29 108 41 2 138 3 rplI Large ribosomal subunit protein bL9 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MJ13 8.5e-29 107 40 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
C3M9A8 1.55e-28 106 40 3 151 3 rplI Large ribosomal subunit protein bL9 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B5YIM4 1.6e-28 105 38 2 149 3 rplI Large ribosomal subunit protein bL9 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A1VF28 1.83e-28 105 39 2 149 3 rplI Large ribosomal subunit protein bL9 Nitratidesulfovibrio vulgaris (strain DP4)
Q72DH1 1.83e-28 105 39 2 149 3 rplI Large ribosomal subunit protein bL9 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8FI54 1.94e-28 105 40 2 149 3 rplI Large ribosomal subunit protein bL9 Desulfatibacillum aliphaticivorans
Q0AQD4 2.42e-28 106 42 2 138 3 rplI Large ribosomal subunit protein bL9 Maricaulis maris (strain MCS10)
B4RAE8 3.05e-28 105 44 2 138 3 rplI Large ribosomal subunit protein bL9 Phenylobacterium zucineum (strain HLK1)
B1LYI1 6.41e-28 105 39 2 144 3 rplI Large ribosomal subunit protein bL9 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A5V2E0 9.73e-28 104 42 2 138 3 rplI Large ribosomal subunit protein bL9 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q9F9K6 1.23e-27 104 39 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium leguminosarum bv. trifolii
Q7UKV4 1.79e-27 103 39 2 148 3 rplI Large ribosomal subunit protein bL9 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B3E6H6 1.84e-27 102 39 2 148 3 rplI Large ribosomal subunit protein bL9 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q6AJZ9 1.9e-27 102 41 2 141 3 rplI Large ribosomal subunit protein bL9 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B9JUT9 2.2e-27 103 39 3 151 3 rplI Large ribosomal subunit protein bL9 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q11H14 2.41e-27 103 40 2 146 3 rplI Large ribosomal subunit protein bL9 Chelativorans sp. (strain BNC1)
B3PUT4 2.95e-27 103 38 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium etli (strain CIAT 652)
B5ZWC6 3.51e-27 103 39 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q07LD6 5.99e-27 102 40 3 148 3 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain BisA53)
Q8UGF0 7.52e-27 102 39 3 151 3 rplI Large ribosomal subunit protein bL9 Agrobacterium fabrum (strain C58 / ATCC 33970)
B3Q9T8 7.86e-27 102 40 2 146 3 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain TIE-1)
Q6N5A1 7.86e-27 102 40 2 146 1 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2KA96 9.45e-27 102 38 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B9M5V1 1.01e-26 100 38 2 146 3 rplI Large ribosomal subunit protein bL9 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C3PKC8 1.17e-26 100 38 1 149 3 rplI Large ribosomal subunit protein bL9 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q3A320 1.61e-26 100 37 2 148 3 rplI Large ribosomal subunit protein bL9 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q28RX5 1.63e-26 102 41 2 144 3 rplI Large ribosomal subunit protein bL9 Jannaschia sp. (strain CCS1)
A6U7G4 1.7e-26 101 39 3 151 3 rplI Large ribosomal subunit protein bL9 Sinorhizobium medicae (strain WSM419)
Q9RY49 2.26e-26 99 35 4 148 1 rplI Large ribosomal subunit protein bL9 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5G7R0 2.3e-26 99 37 2 146 3 rplI Large ribosomal subunit protein bL9 Geotalea uraniireducens (strain Rf4)
B0UL32 2.52e-26 100 40 2 136 3 rplI Large ribosomal subunit protein bL9 Methylobacterium sp. (strain 4-46)
Q215T9 2.67e-26 101 43 2 135 3 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain BisB18)
B4S3C6 2.77e-26 99 37 2 149 3 rplI Large ribosomal subunit protein bL9 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A9WVL2 3.09e-26 99 41 5 151 3 rplI Large ribosomal subunit protein bL9 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q92QZ9 3.99e-26 100 38 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium meliloti (strain 1021)
C1CXJ9 4.06e-26 99 36 4 149 3 rplI Large ribosomal subunit protein bL9 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q0SB54 5.4e-26 99 39 2 149 3 rplI Large ribosomal subunit protein bL9 Rhodococcus jostii (strain RHA1)
B0SWK9 5.62e-26 100 39 2 138 3 rplI Large ribosomal subunit protein bL9 Caulobacter sp. (strain K31)
C0QBV1 5.64e-26 99 34 2 149 3 rplI Large ribosomal subunit protein bL9 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q01QR6 7.2e-26 98 39 4 151 3 rplI Large ribosomal subunit protein bL9 Solibacter usitatus (strain Ellin6076)
A1BJC0 7.23e-26 98 40 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q0C083 8.92e-26 99 40 2 144 3 rplI Large ribosomal subunit protein bL9 Hyphomonas neptunium (strain ATCC 15444)
B9JCB6 1.71e-25 99 38 3 151 3 rplI Large ribosomal subunit protein bL9 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2G8G5 1.9e-25 99 38 2 138 3 rplI Large ribosomal subunit protein bL9 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
C6E506 2.11e-25 97 37 2 146 3 rplI Large ribosomal subunit protein bL9 Geobacter sp. (strain M21)
B5EHW6 2.33e-25 97 37 2 146 3 rplI Large ribosomal subunit protein bL9 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q1GRV8 2.79e-25 99 42 3 138 3 rplI Large ribosomal subunit protein bL9 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q5YN14 2.81e-25 97 37 1 149 3 rplI Large ribosomal subunit protein bL9 Nocardia farcinica (strain IFM 10152)
Q2IX94 3.12e-25 98 41 2 138 3 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain HaA2)
P27151 3.69e-25 96 40 4 150 1 rplI Large ribosomal subunit protein bL9 Thermus thermophilus
B8IEC9 3.88e-25 97 39 2 136 3 rplI Large ribosomal subunit protein bL9 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B3EKG2 5.81e-25 96 36 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobium phaeobacteroides (strain BS1)
B3EEB5 6.09e-25 96 38 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q135M5 7.03e-25 97 41 2 138 3 rplI Large ribosomal subunit protein bL9 Rhodopseudomonas palustris (strain BisB5)
Q6NEI5 9.76e-25 95 37 1 149 3 rplI Large ribosomal subunit protein bL9 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A4T4P0 1.01e-24 95 41 4 151 3 rplI Large ribosomal subunit protein bL9 Mycolicibacterium gilvum (strain PYR-GCK)
B0K5L4 1.05e-24 95 36 2 149 3 rplI Large ribosomal subunit protein bL9 Thermoanaerobacter sp. (strain X514)
B0K8F8 1.05e-24 95 36 2 149 3 rplI Large ribosomal subunit protein bL9 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5SLQ1 1.73e-24 95 39 4 150 1 rplI Large ribosomal subunit protein bL9 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A5CVA8 2.04e-24 95 39 5 152 3 rplI Large ribosomal subunit protein bL9 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A4YT74 2.04e-24 96 37 2 146 3 rplI Large ribosomal subunit protein bL9 Bradyrhizobium sp. (strain ORS 278)
Q89MW6 2.25e-24 96 36 2 146 3 rplI Large ribosomal subunit protein bL9 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B2HIC0 2.44e-24 94 40 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium marinum (strain ATCC BAA-535 / M)
A4FR29 2.7e-24 94 40 0 148 3 rplI Large ribosomal subunit protein bL9 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q5NN59 2.75e-24 96 37 3 146 3 rplI Large ribosomal subunit protein bL9 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q72GV5 2.88e-24 94 38 4 150 1 rplI Large ribosomal subunit protein bL9 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q3SRY6 3.01e-24 95 39 2 146 3 rplI Large ribosomal subunit protein bL9 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2A451 3.03e-24 94 34 2 146 3 rplI Large ribosomal subunit protein bL9 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q2IM65 3.05e-24 94 40 2 149 3 rplI Large ribosomal subunit protein bL9 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8KAM4 3.84e-24 94 37 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q1J218 3.86e-24 94 34 4 149 3 rplI Large ribosomal subunit protein bL9 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B0RDN5 4.29e-24 94 39 5 152 3 rplI Large ribosomal subunit protein bL9 Clavibacter sepedonicus
A8ZRQ0 4.91e-24 94 36 2 149 3 rplI Large ribosomal subunit protein bL9 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B1XN09 5.43e-24 94 34 2 149 3 rplI Large ribosomal subunit protein bL9 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B0TA56 1.28e-23 92 35 3 150 3 rplI Large ribosomal subunit protein bL9 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
P0A499 2.38e-23 92 35 2 150 3 rplI Large ribosomal subunit protein bL9 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A4A0 2.38e-23 92 35 2 150 3 rplI Large ribosomal subunit protein bL9 Synechococcus elongatus
C0QQX0 2.68e-23 92 34 2 149 3 rplI Large ribosomal subunit protein bL9 Persephonella marina (strain DSM 14350 / EX-H1)
Q8FLQ0 2.72e-23 92 36 1 149 3 rplI Large ribosomal subunit protein bL9 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1AXR0 3.02e-23 92 38 6 156 3 rplI Large ribosomal subunit protein bL9 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B4ULB9 3.02e-23 92 38 2 149 3 rplI Large ribosomal subunit protein bL9 Anaeromyxobacter sp. (strain K)
B8J801 3.02e-23 92 38 2 149 3 rplI Large ribosomal subunit protein bL9 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B6JGW6 3.83e-23 92 39 2 138 3 rplI Large ribosomal subunit protein bL9 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q744X5 3.83e-23 91 37 2 151 3 rplI Large ribosomal subunit protein bL9 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
C4LGF9 3.84e-23 91 35 4 153 3 rplI Large ribosomal subunit protein bL9 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
C0ZV42 4.21e-23 91 42 2 150 3 rplI Large ribosomal subunit protein bL9 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A0Q8Y8 5.19e-23 91 37 2 151 3 rplI Large ribosomal subunit protein bL9 Mycobacterium avium (strain 104)
B4SB45 6.01e-23 91 34 2 149 3 rplI Large ribosomal subunit protein bL9 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A0R7F6 7.3e-23 90 36 2 151 1 rplI Large ribosomal subunit protein bL9 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q3B6M4 7.7e-23 90 38 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B0RZP8 9.24e-23 90 36 3 150 3 rplI Large ribosomal subunit protein bL9 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A0PKH8 1.1e-22 90 39 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium ulcerans (strain Agy99)
A4SCJ8 1.16e-22 90 36 2 149 3 rplI Large ribosomal subunit protein bL9 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B7JUZ9 1.2e-22 90 37 4 146 3 rplI Large ribosomal subunit protein bL9 Rippkaea orientalis (strain PCC 8801 / RF-1)
A4QI23 1.33e-22 90 40 4 152 3 rplI Large ribosomal subunit protein bL9 Corynebacterium glutamicum (strain R)
Q82FG6 1.35e-22 90 39 6 153 3 rplI Large ribosomal subunit protein bL9 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P9WH79 1.59e-22 90 38 4 152 1 rplI Large ribosomal subunit protein bL9 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH78 1.59e-22 90 38 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TYC7 1.59e-22 90 38 4 152 1 rplI Large ribosomal subunit protein bL9 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AJ79 1.59e-22 90 38 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KEM4 1.59e-22 90 38 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66316 1.59e-22 90 38 4 152 3 rplI Large ribosomal subunit protein bL9 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4JSG1 1.62e-22 90 36 1 149 3 rplI Large ribosomal subunit protein bL9 Corynebacterium jeikeium (strain K411)
B0JQ94 1.66e-22 90 35 2 150 3 rplI Large ribosomal subunit protein bL9 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A9KKB3 1.88e-22 89 40 5 146 3 rplI Large ribosomal subunit protein bL9 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
C4XGN5 2.57e-22 90 36 2 147 3 rplI Large ribosomal subunit protein bL9 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A1AM21 2.58e-22 89 36 2 144 3 rplI Large ribosomal subunit protein bL9 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1QKP2 2.81e-22 90 36 2 146 3 rplI Large ribosomal subunit protein bL9 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q9X8U5 2.84e-22 89 39 6 153 3 rplI Large ribosomal subunit protein bL9 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C6BVB0 3.15e-22 90 34 2 146 3 rplI Large ribosomal subunit protein bL9 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A0K2H2 3.19e-22 89 37 3 148 3 rplI Large ribosomal subunit protein bL9 Arthrobacter sp. (strain FB24)
C5C7U8 3.96e-22 89 38 5 152 3 rplI Large ribosomal subunit protein bL9 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B4U7M7 4.71e-22 89 33 2 144 3 rplI Large ribosomal subunit protein bL9 Hydrogenobaculum sp. (strain Y04AAS1)
B7J145 5.45e-22 89 36 2 136 3 rplI Large ribosomal subunit protein bL9 Borreliella burgdorferi (strain ZS7)
O51139 5.45e-22 89 36 2 136 1 rplI Large ribosomal subunit protein bL9 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8NLG1 5.52e-22 88 39 4 152 3 rplI Large ribosomal subunit protein bL9 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B2S1U6 5.73e-22 89 37 3 150 3 rplI Large ribosomal subunit protein bL9 Borrelia hermsii (strain HS1 / DAH)
A1THY4 6.04e-22 88 39 4 151 3 rplI Large ribosomal subunit protein bL9 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q47K97 6.17e-22 88 37 5 152 3 rplI Large ribosomal subunit protein bL9 Thermobifida fusca (strain YX)
A5GWP0 6.33e-22 88 32 2 149 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain RCC307)
A5GPH9 6.47e-22 88 33 2 149 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain WH7803)
A3DHN0 7.33e-22 88 35 3 150 3 rplI Large ribosomal subunit protein bL9 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A7H6J2 7.52e-22 88 37 2 137 3 rplI Large ribosomal subunit protein bL9 Anaeromyxobacter sp. (strain Fw109-5)
A5N434 7.55e-22 88 35 5 148 3 rplI Large ribosomal subunit protein bL9 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXQ4 7.55e-22 88 35 5 148 3 rplI Large ribosomal subunit protein bL9 Clostridium kluyveri (strain NBRC 12016)
B0CAV7 7.61e-22 88 35 2 150 3 rplI Large ribosomal subunit protein bL9 Acaryochloris marina (strain MBIC 11017)
Q2RM68 8.41e-22 88 36 3 150 3 rplI Large ribosomal subunit protein bL9 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A5EI95 9.37e-22 89 34 2 146 3 rplI Large ribosomal subunit protein bL9 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q5N1S9 1.1e-21 87 34 2 149 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31K30 1.1e-21 87 34 2 149 3 rplI Large ribosomal subunit protein bL9 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B3QVR4 1.63e-21 87 34 2 144 3 rplI Large ribosomal subunit protein bL9 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B1MMH9 1.72e-21 87 37 3 151 3 rplI Large ribosomal subunit protein bL9 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q7U3Q2 2.19e-21 87 36 5 152 3 rplI Large ribosomal subunit protein bL9 Parasynechococcus marenigrum (strain WH8102)
A9BDB8 2.28e-21 87 34 4 152 3 rplI Large ribosomal subunit protein bL9 Prochlorococcus marinus (strain MIT 9211)
C1B716 2.3e-21 87 39 2 150 3 rplI Large ribosomal subunit protein bL9 Rhodococcus opacus (strain B4)
Q2GEY5 3.07e-21 87 35 2 147 3 rplI Large ribosomal subunit protein bL9 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q8A5S7 3.38e-21 86 36 2 149 3 rplI Large ribosomal subunit protein bL9 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q3ANR2 3.9e-21 86 37 2 138 3 rplI Large ribosomal subunit protein bL9 Chlorobium chlorochromatii (strain CaD3)
Q0I6E0 4.85e-21 86 32 2 149 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain CC9311)
A0LWU2 4.91e-21 86 36 3 149 3 rplI Large ribosomal subunit protein bL9 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B2GJD5 5.77e-21 85 40 5 150 3 rplI Large ribosomal subunit protein bL9 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q3AGL2 6.08e-21 85 35 5 151 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain CC9605)
O67830 6.85e-21 85 37 2 149 3 rplI Large ribosomal subunit protein bL9 Aquifex aeolicus (strain VF5)
A6H0P1 7.18e-21 85 41 5 152 3 rplI Large ribosomal subunit protein bL9 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A5FE75 9.88e-21 85 42 5 152 3 rplI Large ribosomal subunit protein bL9 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A8LXG0 1.11e-20 85 35 5 151 3 rplI Large ribosomal subunit protein bL9 Salinispora arenicola (strain CNS-205)
Q0SP52 1.17e-20 85 34 1 135 3 rplI Large ribosomal subunit protein bL9 Borreliella afzelii (strain PKo)
B8H838 1.37e-20 85 37 5 151 3 rplI Large ribosomal subunit protein bL9 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A6WG60 1.61e-20 85 37 5 154 3 rplI Large ribosomal subunit protein bL9 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
P46385 1.62e-20 85 39 4 140 3 rplI Large ribosomal subunit protein bL9 Mycobacterium leprae (strain TN)
B8ZTL4 1.62e-20 85 39 4 140 3 rplI Large ribosomal subunit protein bL9 Mycobacterium leprae (strain Br4923)
B8I4B5 1.74e-20 84 34 3 147 3 rplI Large ribosomal subunit protein bL9 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q5L9B7 1.93e-20 84 37 2 149 3 rplI Large ribosomal subunit protein bL9 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64PH9 2.32e-20 84 37 2 149 3 rplI Large ribosomal subunit protein bL9 Bacteroides fragilis (strain YCH46)
Q1IHW5 2.58e-20 84 34 2 149 3 rplI Large ribosomal subunit protein bL9 Koribacter versatilis (strain Ellin345)
B3CLJ5 2.6e-20 85 36 1 147 3 rplI Large ribosomal subunit protein bL9 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A0LN56 3.91e-20 84 32 2 149 3 rplI Large ribosomal subunit protein bL9 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B1H014 4.97e-20 83 32 2 149 3 rplI Large ribosomal subunit protein bL9 Endomicrobium trichonymphae
Q2JMI4 5.41e-20 83 35 4 151 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain JA-2-3B'a(2-13))
B5RLI6 6.07e-20 84 34 3 152 3 rplI Large ribosomal subunit protein bL9 Borrelia duttonii (strain Ly)
B5RQT9 7.52e-20 83 36 3 133 3 rplI Large ribosomal subunit protein bL9 Borrelia recurrentis (strain A1)
Q3AUG8 8.67e-20 83 34 4 150 3 rplI Large ribosomal subunit protein bL9 Synechococcus sp. (strain CC9902)
Q662Q0 8.87e-20 83 33 1 135 3 rplI Large ribosomal subunit protein bL9 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A8L8T1 9.44e-20 82 35 5 152 3 rplI Large ribosomal subunit protein bL9 Parafrankia sp. (strain EAN1pec)
A0M0D9 1.04e-19 82 34 1 149 3 rplI Large ribosomal subunit protein bL9 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A8MKJ7 1.22e-19 82 34 3 147 3 rplI Large ribosomal subunit protein bL9 Alkaliphilus oremlandii (strain OhILAs)
P42352 1.47e-19 82 33 2 145 3 rplI Large ribosomal subunit protein bL9 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B2V6V8 1.52e-19 82 31 2 149 3 rplI Large ribosomal subunit protein bL9 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q2J4C7 1.53e-19 82 36 3 145 3 rplI Large ribosomal subunit protein bL9 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q5PBM9 1.59e-19 84 35 3 147 3 rplI Large ribosomal subunit protein bL9 Anaplasma marginale (strain St. Maries)
Q1B0W7 1.65e-19 82 35 2 151 3 rplI Large ribosomal subunit protein bL9 Mycobacterium sp. (strain MCS)
A1UP83 1.65e-19 82 35 2 151 3 rplI Large ribosomal subunit protein bL9 Mycobacterium sp. (strain KMS)
A3Q8M9 1.65e-19 82 35 2 151 3 rplI Large ribosomal subunit protein bL9 Mycobacterium sp. (strain JLS)
B9KHP7 2.21e-19 83 35 3 147 3 rplI Large ribosomal subunit protein bL9 Anaplasma marginale (strain Florida)
Q5GSD4 2.35e-19 82 37 4 139 3 rplI Large ribosomal subunit protein bL9 Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q73M35 2.45e-19 83 32 1 149 3 rplI Large ribosomal subunit protein bL9 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A4XDG5 2.54e-19 81 35 5 151 3 rplI Large ribosomal subunit protein bL9 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16805
Feature type CDS
Gene rplI
Product 50S ribosomal protein L9
Location 3703794 - 3704243 (strand: 1)
Length 450 (nucleotides) / 149 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1431
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01281 Ribosomal protein L9, N-terminal domain
PF03948 Ribosomal protein L9, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0359 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L9

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02939 large subunit ribosomal protein L9 Ribosome -

Protein Sequence

MQIILLDKVANLGSLGDQVNVKSGYARNYLIPQGKAVSATKKNIEFFEARRAELEAKLAETLAAAEARAAKITALGSVTISSKAGDEGKLFGSIGTRDIADAVTAAGVEICKSEVRLPNGVLRTTGDHEVHFQVHSDVFAELNVIIVAE

Flanking regions ( +/- flanking 50bp)

TCAGTAATAGGTATTATATAGTCCATTAATGACTTGTAGAGGATAAGGTAATGCAAATTATTCTGCTTGATAAAGTAGCGAATCTGGGTAGCCTGGGTGATCAGGTTAACGTAAAATCGGGCTATGCTCGTAACTATTTAATCCCACAGGGTAAAGCTGTTTCTGCGACTAAGAAAAACATCGAGTTTTTCGAAGCGCGTCGTGCTGAGTTAGAAGCTAAATTAGCTGAAACTTTAGCGGCAGCTGAAGCTCGTGCAGCGAAAATCACTGCACTGGGATCTGTCACTATCAGCTCTAAAGCGGGTGACGAAGGTAAACTGTTTGGTTCAATCGGTACACGTGACATCGCTGATGCAGTAACTGCAGCTGGCGTTGAAATTTGTAAGAGCGAAGTTCGCCTGCCAAACGGCGTTCTGCGTACAACTGGTGACCACGAAGTTCACTTCCAAGTTCACAGTGACGTATTCGCTGAACTGAATGTAATCATCGTTGCTGAATAATCATTAGATTAAATAGTTATGTTGATAGAAAAACGCCAGCTTAGCTGGCG