Homologs in group_4696
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q9A4S4 | 6.9e-05 | 42 | 25 | 2 | 101 | 1 | parE3 | Toxin ParE3 | Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS16715 |
| Feature type | CDS |
| Gene | - |
| Product | type II toxin-antitoxin system RelE/ParE family toxin |
| Location | 3684843 - 3685169 (strand: -1) |
| Length | 327 (nucleotides) / 108 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4696 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF05016 | ParE toxin of type II toxin-antitoxin system, parDE |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG3668 | Mobilome: prophages, transposons (X) | X | Plasmid stabilization system protein ParE |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K19092 | toxin ParE1/3/4 | - | - |
MASYKVVMTKDAETDLEDINNYIADHDSIDNADYVLDELLKVTNTQANFPMKGSIPKELQSLGIREYQQIFFKPYRVIYHTIAKQVVIFIIADGRRDMQALLTRRLLG
GATATAAAAAGCGTGGTTCAGCGTTTAAAAAGTAAAAGGAAATAATCGTAATGGCGTCCTATAAAGTGGTAATGACGAAAGATGCCGAAACAGACTTAGAGGACATCAATAACTATATTGCCGACCACGACAGCATAGATAATGCAGATTATGTATTAGATGAGCTGCTTAAGGTCACTAATACACAGGCTAACTTTCCTATGAAAGGCAGTATTCCAAAGGAATTACAAAGTTTAGGTATTCGTGAATATCAGCAAATCTTTTTTAAACCTTATCGTGTCATCTATCACACAATAGCAAAACAAGTGGTTATCTTTATTATTGCGGATGGCAGACGAGACATGCAAGCCCTGCTTACTCGGCGACTTTTAGGGTAAAAATATCTTACTGTATATTCTTATCATAGAGAGACAGGCCGACTTCTAAA
