Homologs in group_1742

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12145 FBDBKF_12145 83.9 Morganella morganii S1 sthA Si-specific NAD(P)(+) transhydrogenase
EHELCC_14160 EHELCC_14160 83.9 Morganella morganii S2 sthA Si-specific NAD(P)(+) transhydrogenase
NLDBIP_15255 NLDBIP_15255 83.9 Morganella morganii S4 sthA Si-specific NAD(P)(+) transhydrogenase
LHKJJB_15355 LHKJJB_15355 83.9 Morganella morganii S3 sthA Si-specific NAD(P)(+) transhydrogenase
HKOGLL_14475 HKOGLL_14475 83.9 Morganella morganii S5 sthA Si-specific NAD(P)(+) transhydrogenase
F4V73_RS16940 F4V73_RS16940 83.7 Morganella psychrotolerans sthA Si-specific NAD(P)(+) transhydrogenase

Distribution of the homologs in the orthogroup group_1742

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1742

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1H1 0.0 966 100 0 465 3 sthA Soluble pyridine nucleotide transhydrogenase Proteus mirabilis (strain HI4320)
Q7MBG9 0.0 856 87 0 465 3 sthA Soluble pyridine nucleotide transhydrogenase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JI37 0.0 815 83 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQ50 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G61 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRG4 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pestis (strain Pestoides F)
Q1CNP4 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6N5 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZA97 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pestis
B2JZF3 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBU5 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD10 0.0 813 82 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6CZB1 0.0 807 82 0 460 3 sthA Soluble pyridine nucleotide transhydrogenase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GL77 0.0 802 82 1 464 3 sthA Soluble pyridine nucleotide transhydrogenase Serratia proteamaculans (strain 568)
A6TGE6 0.0 800 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZ14 0.0 799 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Klebsiella pneumoniae (strain 342)
B1LNS2 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain SMS-3-5 / SECEC)
B1IVB6 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FB93 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A770 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O9:H4 (strain HS)
C0Q478 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella paratyphi C (strain RKS4594)
Q57H91 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella choleraesuis (strain SC-B67)
B7LUN3 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3U7 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain UTI89 / UPEC)
B6I5I0 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain SE11)
B7NFR2 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P27306 0.0 798 80 1 466 1 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain K12)
A1AIE2 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O1:K1 / APEC
B1XBX3 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain K12 / DH10B)
C5A0R1 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M718 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O8 (strain IAI1)
B7NU38 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z064 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O157:H7 (strain EC4115 / EHEC)
B7LA64 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli (strain 55989 / EAEC)
B7MIA0 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZUI2 0.0 798 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O139:H28 (strain E24377A / ETEC)
P66008 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66009 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella typhi
B5BJN6 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella paratyphi A (strain AKU_12601)
A9N0H2 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK71 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5QXQ7 0.0 798 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella enteritidis PT4 (strain P125109)
B2TWF7 0.0 797 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7MR55 0.0 797 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O81 (strain ED1a)
B7UNU0 0.0 797 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0TA96 0.0 796 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83MI1 0.0 796 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Shigella flexneri
B5REZ6 0.0 796 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8X727 0.0 795 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Escherichia coli O157:H7
A4WG49 0.0 795 80 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Enterobacter sp. (strain 638)
A8AKW0 0.0 792 81 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VGA0 0.0 781 79 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQZ3 0.0 757 77 1 460 3 sthA Soluble pyridine nucleotide transhydrogenase Sodalis glossinidius (strain morsitans)
C3LPZ2 0.0 749 76 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio cholerae serotype O1 (strain M66-2)
P50529 0.0 749 76 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4K5 0.0 749 76 0 464 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VM91 0.0 744 76 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio atlanticus (strain LGP32)
Q87KN5 0.0 741 75 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MQ83 0.0 738 74 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio vulnificus (strain YJ016)
Q8DD46 0.0 738 74 1 466 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio vulnificus (strain CMCP6)
Q6LLT9 0.0 730 74 0 462 3 sthA Soluble pyridine nucleotide transhydrogenase Photobacterium profundum (strain SS9)
Q5E212 0.0 730 73 0 465 3 sthA Soluble pyridine nucleotide transhydrogenase Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4K3I8 0.0 729 74 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q48A14 0.0 680 69 0 460 3 sthA Soluble pyridine nucleotide transhydrogenase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A6V3A6 0.0 619 63 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain PA7)
P57112 0.0 619 63 1 465 1 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PF5 0.0 619 63 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZU5 0.0 619 63 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain LESB58)
Q9XBQ9 0.0 617 63 1 465 1 sthA Soluble pyridine nucleotide transhydrogenase Azotobacter vinelandii
C1DR10 0.0 617 63 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1U1Y5 0.0 612 62 2 465 3 sthA Soluble pyridine nucleotide transhydrogenase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4VMU6 0.0 602 61 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Stutzerimonas stutzeri (strain A1501)
Q4ZV77 0.0 602 61 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas syringae pv. syringae (strain B728a)
A4XSQ1 0.0 601 61 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas mendocina (strain ymp)
Q48KI8 0.0 601 61 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q884I6 0.0 600 60 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1QX78 0.0 597 61 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1I7F0 0.0 595 61 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas entomophila (strain L48)
Q4KFA6 0.0 595 61 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1J606 0.0 595 60 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas putida (strain W619)
Q88KY8 0.0 595 60 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3K9F5 0.0 595 61 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas fluorescens (strain Pf0-1)
A5W6F5 0.0 595 60 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KH90 0.0 594 61 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas putida (strain GB-1)
O05139 0.0 594 61 1 461 1 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas fluorescens
C3K4W1 0.0 592 60 1 461 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas fluorescens (strain SBW25)
A6VW16 0.0 588 61 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Marinomonas sp. (strain MWYL1)
Q2SIP2 0.0 586 63 1 465 3 sthA Soluble pyridine nucleotide transhydrogenase Hahella chejuensis (strain KCTC 2396)
P9WHH5 9.4e-125 374 42 5 465 1 sthA Probable soluble pyridine nucleotide transhydrogenase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH4 9.4e-125 374 42 5 465 3 sthA Probable soluble pyridine nucleotide transhydrogenase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U665 9.4e-125 374 42 5 465 3 sthA Soluble pyridine nucleotide transhydrogenase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFH2 9.4e-125 374 42 5 465 3 sthA Soluble pyridine nucleotide transhydrogenase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM51 9.4e-125 374 42 5 465 3 sthA Soluble pyridine nucleotide transhydrogenase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66007 9.4e-125 374 42 5 465 3 sthA Probable soluble pyridine nucleotide transhydrogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P71317 3.75e-95 286 91 0 150 3 sthA Soluble pyridine nucleotide transhydrogenase (Fragment) Pectobacterium carotovorum subsp. carotovorum
Q9Z773 4.64e-65 219 33 9 460 3 lpdA Dihydrolipoyl dehydrogenase Chlamydia pneumoniae
Q9HUY1 1.89e-61 210 32 8 469 3 lpd3 Dihydrolipoyl dehydrogenase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57303 2.62e-61 210 31 7 457 3 lpdA Dihydrolipoyl dehydrogenase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KCW2 5.72e-61 209 31 9 468 3 lpd Dihydrolipoyl dehydrogenase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P49819 6.55e-60 207 30 7 464 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial Canis lupus familiaris
Q8CIZ7 7.27e-60 207 30 8 472 2 DLD Dihydrolipoyl dehydrogenase, mitochondrial Cricetulus griseus
P09623 1.27e-59 206 30 8 465 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial Sus scrofa
P09622 1.43e-59 206 30 8 465 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial Homo sapiens
F1N206 1.82e-59 206 30 8 465 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial Bos taurus
Q811C4 4.26e-59 204 30 8 468 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial (Fragment) Mesocricetus auratus
Q60HG3 5.13e-59 205 30 8 465 2 DLD Dihydrolipoyl dehydrogenase, mitochondrial Macaca fascicularis
O84561 1.3e-58 202 30 7 456 3 lpdA Dihydrolipoyl dehydrogenase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O50311 1.76e-58 202 31 7 465 3 lpd Dihydrolipoyl dehydrogenase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q6P6R2 2.43e-58 203 30 8 465 1 Dld Dihydrolipoyl dehydrogenase, mitochondrial Rattus norvegicus
Q5R4B1 5.37e-58 202 30 8 465 2 DLD Dihydrolipoyl dehydrogenase, mitochondrial Pongo abelii
O08749 6.82e-58 202 29 8 465 1 Dld Dihydrolipoyl dehydrogenase, mitochondrial Mus musculus
Q9PJI3 7.81e-58 201 30 7 456 3 lpdA Dihydrolipoyl dehydrogenase Chlamydia muridarum (strain MoPn / Nigg)
P43784 1.07e-57 200 29 9 458 3 lpdA Dihydrolipoyl dehydrogenase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P11959 1.14e-56 197 30 7 455 1 pdhD Dihydrolipoyl dehydrogenase Geobacillus stearothermophilus
O17953 2.42e-56 197 30 10 468 3 dld-1 Dihydrolipoyl dehydrogenase, mitochondrial Caenorhabditis elegans
P31046 2.95e-56 196 31 6 461 1 lpd3 Dihydrolipoyl dehydrogenase 3 Pseudomonas putida
P14218 4.53e-56 196 30 5 463 1 lpd Dihydrolipoyl dehydrogenase Pseudomonas fluorescens
G0SB20 5.58e-56 196 30 7 468 1 CTHT_0048590 Dihydrolipoamide dehydrogenase Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q9I3D1 1.3e-55 195 29 5 463 1 lpdG Dihydrolipoyl dehydrogenase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P18925 4.83e-55 193 29 6 463 1 None Dihydrolipoyl dehydrogenase Azotobacter vinelandii
O50286 5.13e-55 193 29 10 458 3 lpd Dihydrolipoyl dehydrogenase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KPF6 6.13e-55 193 29 10 459 3 lpd Dihydrolipoyl dehydrogenase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q04933 7.03e-55 193 30 7 451 3 None Dihydrolipoyl dehydrogenase Trypanosoma brucei brucei
Q9M5K3 1.6e-54 192 28 6 447 1 LPD1 Dihydrolipoyl dehydrogenase 1, mitochondrial Arabidopsis thaliana
Q9M5K2 2.18e-54 192 29 7 447 1 LPD2 Dihydrolipoyl dehydrogenase 2, mitochondrial Arabidopsis thaliana
P21880 6.04e-54 190 30 9 459 3 pdhD Dihydrolipoyl dehydrogenase Bacillus subtilis (strain 168)
P90597 8.9e-54 190 30 9 450 1 LPD Dihydrolipoyl dehydrogenase Trypanosoma cruzi
Q9SPB1 9.62e-54 191 28 5 446 1 FLBR Leghemoglobin reductase Vigna unguiculata
P31052 1.04e-53 190 29 7 467 1 lpdG Dihydrolipoyl dehydrogenase Pseudomonas putida
P31023 1.64e-53 190 28 6 446 1 LPD Dihydrolipoyl dehydrogenase, mitochondrial Pisum sativum
P0A0E4 1.89e-53 191 30 11 463 3 merA Mercuric reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0A0E5 1.89e-53 191 30 11 463 3 merA Mercuric reductase Staphylococcus aureus
P0A0E7 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MW2)
P0A0E8 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus
Q6GAB8 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MSSA476)
Q6GHY9 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MRSA252)
P99084 3.32e-53 188 29 7 455 1 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain N315)
P0A0E6 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY8 3.32e-53 188 29 7 455 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain COL)
O00087 4.71e-53 189 29 8 472 2 dld1 Dihydrolipoyl dehydrogenase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O34324 1.05e-52 187 30 10 450 3 acoL Dihydrolipoyl dehydrogenase Bacillus subtilis (strain 168)
P50970 1.06e-52 187 29 7 465 3 lpd Dihydrolipoyl dehydrogenase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8K9T7 1.89e-52 186 30 10 471 3 lpdA Dihydrolipoyl dehydrogenase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q41219 1.96e-52 187 28 6 446 1 FLBR Leghemoglobin reductase Glycine max
O05940 3.44e-52 186 28 12 487 3 lpdA Dihydrolipoyl dehydrogenase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
O18480 7.18e-52 185 31 10 465 2 None Dihydrolipoyl dehydrogenase Manduca sexta
Q5UWH2 4.36e-51 183 28 8 470 3 lpdA3 Dihydrolipoyl dehydrogenase 3 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P52992 6.88e-51 182 30 10 470 3 odhL Dihydrolipoyl dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P23189 7.23e-51 182 30 10 453 3 gor Glutathione reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
D9J041 3.09e-50 182 29 10 465 1 merA Mercuric reductase Lysinibacillus sphaericus
P0A9P3 1.21e-49 179 27 10 459 3 lpdA Dihydrolipoyl dehydrogenase Shigella flexneri
P0A9P0 1.21e-49 179 27 10 459 1 lpdA Dihydrolipoyl dehydrogenase Escherichia coli (strain K12)
P0A9P1 1.21e-49 179 27 10 459 3 lpdA Dihydrolipoyl dehydrogenase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9P2 1.21e-49 179 27 10 459 3 lpdA Dihydrolipoyl dehydrogenase Escherichia coli O157:H7
P09624 1.38e-49 179 28 8 487 1 LPD1 Dihydrolipoyl dehydrogenase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54EW8 2.5e-49 178 28 7 445 3 lpd Dihydrolipoyl dehydrogenase, mitochondrial Dictyostelium discoideum
P48639 5.44e-49 176 29 7 455 3 gor Glutathione reductase Burkholderia cepacia
P85207 2.04e-48 175 29 9 459 1 lpd Dihydrolipoyl dehydrogenase Thermus scotoductus (strain ATCC 700910 / SA-01)
Q04829 7.92e-48 174 29 9 463 1 lpdA Dihydrolipoyl dehydrogenase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P95596 3.21e-47 172 30 8 440 3 lpd Dihydrolipoyl dehydrogenase Rhodobacter capsulatus
P48638 6.31e-47 171 29 9 464 3 gor Glutathione reductase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P48642 1.26e-45 169 28 8 460 2 GRC2 Glutathione reductase, cytosolic Oryza sativa subsp. japonica
D0VWY5 1.49e-45 167 30 10 455 1 garB Glutathione amide reductase Marichromatium gracile
Q5UYG6 3.87e-45 167 29 10 455 3 lpdA2 Dihydrolipoyl dehydrogenase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P16171 3.92e-45 169 28 9 462 1 merA Mercuric reductase Bacillus cereus
Q43154 1.18e-44 166 28 8 462 2 None Glutathione reductase, chloroplastic (Fragment) Spinacia oleracea
Q9HN74 1.46e-44 165 28 10 466 3 lpdA Dihydrolipoyl dehydrogenase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P30341 2.95e-44 164 29 7 465 2 merA Mercuric reductase Streptomyces lividans
Q89AQ8 5.05e-44 164 30 11 472 3 lpdA Dihydrolipoyl dehydrogenase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P54533 6.54e-44 163 29 9 468 3 bfmBC Dihydrolipoyl dehydrogenase Bacillus subtilis (strain 168)
Q54465 1.79e-43 164 26 7 451 3 merA Mercuric reductase Shewanella putrefaciens
P42770 8.21e-42 159 28 11 467 2 EMB2360 Glutathione reductase, chloroplastic Arabidopsis thaliana
Q50068 3.23e-41 156 29 12 463 3 lpd Dihydrolipoyl dehydrogenase Mycobacterium leprae (strain TN)
O04955 4.14e-41 156 27 8 466 2 GR1 Glutathione reductase, cytosolic Brassica rapa subsp. pekinensis
P77212 5.25e-41 155 27 8 465 1 rclA Probable pyridine nucleotide-disulfide oxidoreductase RclA Escherichia coli (strain K12)
P78965 6.64e-41 155 28 14 468 1 pgr1 Glutathione reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P48641 9.4e-41 155 27 8 466 1 At3g24170 Glutathione reductase, cytosolic Arabidopsis thaliana
Q43621 9.44e-41 155 26 6 461 2 None Glutathione reductase, cytosolic Pisum sativum
P80461 2.72e-40 155 29 14 469 1 GOR Glutathione reductase, chloroplastic (Fragment) Nicotiana tabacum
P72740 1.61e-39 151 28 10 469 1 lpdA Dihydrolipoyl dehydrogenase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P08332 6.34e-39 151 27 9 460 3 merA Mercuric reductase Shigella flexneri
Q8NTE1 7.01e-39 149 27 9 465 1 lpd Dihydrolipoyl dehydrogenase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P27456 1.34e-38 150 28 13 469 2 GR Glutathione reductase, chloroplastic/mitochondrial Pisum sativum
P48640 2.52e-37 146 28 10 434 2 GR Glutathione reductase, chloroplastic Glycine max
Q52109 2.91e-37 147 26 9 461 3 merA Mercuric reductase Acinetobacter calcoaceticus
P43783 6.6e-37 144 28 12 435 3 gor Glutathione reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94188 1.26e-36 145 27 10 457 3 merA Mercuric reductase Alcaligenes sp.
P00392 1.65e-36 144 26 9 457 1 merA Mercuric reductase Pseudomonas aeruginosa
Q02733 1.84e-36 143 27 12 472 1 IRC15 Increased recombination centers protein 15 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WHH7 1.97e-36 143 27 9 465 1 lpdA NAD(P)H dehydrogenase (quinone) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH6 1.97e-36 143 27 9 465 3 lpdA NAD(P)H dehydrogenase (quinone) Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q74ZK4 7.03e-36 141 27 15 469 3 GLR1 Glutathione reductase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
P94702 7.86e-36 142 26 10 461 3 merA Mercuric reductase Enterobacter agglomerans
P06715 1.49e-35 140 27 10 433 1 gor Glutathione reductase Escherichia coli (strain K12)
F4JLP5 5.87e-35 140 29 15 422 2 LPD2 Dihydrolipoyl dehydrogenase 2, chloroplastic Arabidopsis thaliana
P75393 8.19e-35 138 27 11 458 1 pdhD Dihydrolipoyl dehydrogenase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P41921 9.86e-35 138 25 11 463 1 GLR1 Glutathione reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6C5H4 1.33e-34 138 28 16 480 3 GLR1 Glutathione reductase Yarrowia lipolytica (strain CLIB 122 / E 150)
P9WHH9 6.59e-34 135 28 9 458 1 lpdC Dihydrolipoyl dehydrogenase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH8 6.59e-34 135 28 9 458 3 lpdC Dihydrolipoyl dehydrogenase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66005 6.59e-34 135 28 9 458 3 lpd Dihydrolipoyl dehydrogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P91938 7.25e-34 137 27 15 477 1 Trxr1 Thioredoxin reductase 1, mitochondrial Drosophila melanogaster
Q873E8 9.84e-34 135 27 15 467 3 gtr-1 Glutathione reductase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q6HA23 1.09e-33 135 26 15 471 1 GLR1 Glutathione reductase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P47513 1.36e-33 135 29 13 467 3 pdhD Dihydrolipoyl dehydrogenase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A8MS68 1.66e-33 136 29 13 421 2 LPD1 Dihydrolipoyl dehydrogenase 1, chloroplastic Arabidopsis thaliana
Q9N2I8 1.95e-33 135 26 11 480 1 TXNRD2 Thioredoxin reductase 2, mitochondrial Bos taurus
P47791 2.39e-33 135 27 9 461 1 Gsr Glutathione reductase, mitochondrial Mus musculus
Q9I1L9 7.95e-33 132 24 9 462 1 lpdV Dihydrolipoyl dehydrogenase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P17239 8.14e-33 134 25 12 458 1 merA Mercuric reductase Acidithiobacillus ferrooxidans
Q6FRV2 1.24e-32 132 26 12 465 3 GLR1 Glutathione reductase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q51772 1.4e-32 133 26 9 457 3 merA Mercuric reductase Pseudomonas fluorescens
A2TIL1 2.44e-32 132 27 8 459 2 GSR Glutathione reductase, mitochondrial Callithrix jacchus
P09063 5.33e-32 130 26 12 439 1 lpdV Dihydrolipoyl dehydrogenase Pseudomonas putida
P39051 7.42e-31 127 27 15 478 1 TPR Trypanothione reductase Trypanosoma brucei brucei
P9WHH3 8.64e-31 127 25 10 432 1 mtr Mycothione reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH2 8.64e-31 127 25 10 432 3 mtr Mycothione reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9JLT4 1.61e-30 127 27 15 457 1 Txnrd2 Thioredoxin reductase 2, mitochondrial Mus musculus
P13110 1.74e-30 126 26 13 470 1 TPR Trypanothione reductase Trypanosoma congolense
P00390 1.93e-30 127 27 10 462 1 GSR Glutathione reductase, mitochondrial Homo sapiens
P30635 1.93e-30 126 25 15 474 3 trxr-2 Probable glutathione reductase 2 Caenorhabditis elegans
Q60151 2.45e-30 125 25 9 432 3 gor Glutathione reductase Streptococcus thermophilus
P28593 3.15e-30 125 26 14 482 1 TPR Trypanothione reductase Trypanosoma cruzi
P39040 1.51e-29 124 25 15 476 1 TPR Trypanothione reductase Crithidia fasciculata
P39050 2.56e-29 123 26 13 471 3 TPR Trypanothione reductase Leishmania donovani
Q9Z0J5 1.2e-28 122 25 12 440 1 Txnrd2 Thioredoxin reductase 2, mitochondrial Rattus norvegicus
Q8T137 1.68e-28 120 25 16 465 1 gsr Glutathione reductase Dictyostelium discoideum
Q9NNW7 2.17e-28 121 26 15 464 1 TXNRD2 Thioredoxin reductase 2, mitochondrial Homo sapiens
Q9VNT5 3.81e-28 120 25 16 485 2 Trxr2 Thioredoxin reductase 2, mitochondrial Drosophila melanogaster
Q25861 2.5e-27 118 24 15 494 1 TRXR Thioredoxin reductase Plasmodium falciparum (isolate FCH-5)
P61076 5.26e-27 117 25 14 460 1 TRXR Thioredoxin reductase Plasmodium falciparum (isolate 3D7)
B9A1H3 9.42e-26 113 25 14 483 1 SEP1 Thioredoxin reductase SEP1 Emiliania huxleyi
P70619 2.13e-25 111 25 10 425 2 Gsr Glutathione reductase (Fragment) Rattus norvegicus
Q99MD6 3.55e-25 112 26 15 437 1 Txnrd3 Thioredoxin reductase 3 Mus musculus
O62768 1.78e-24 109 26 15 441 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Bos taurus
Q6BPI1 8.77e-24 107 25 17 485 3 GLR1 Glutathione reductase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q93379 4.65e-23 105 26 9 354 1 gsr-1 Glutathione reductase, mitochondrial Caenorhabditis elegans
Q5NVA2 7.93e-23 104 25 16 443 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Pongo abelii
O89049 1.53e-22 103 25 15 443 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Rattus norvegicus
Q16881 4.59e-22 102 25 16 443 1 TXNRD1 Thioredoxin reductase 1, cytoplasmic Homo sapiens
Q9JMH6 4.62e-22 102 26 16 443 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Mus musculus
Q9MYY8 1.86e-21 100 24 15 441 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Sus scrofa
P35484 1.42e-19 92 28 10 321 3 pdhD Dihydrolipoyl dehydrogenase (Fragment) Acholeplasma laidlawii
Q86VQ6 3.14e-19 94 25 16 440 1 TXNRD3 Thioredoxin reductase 3 Homo sapiens
O15770 4e-18 90 23 14 502 1 GR Glutathione reductase Plasmodium falciparum (isolate 3D7)
Q94655 4.69e-18 90 23 14 502 1 GR Glutathione reductase Plasmodium falciparum (isolate K1 / Thailand)
Q56839 2.45e-14 78 21 15 475 1 xecC 2-oxopropyl-CoM reductase, carboxylating Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q17745 2.73e-14 79 25 6 262 1 trxr-1 Thioredoxin reductase 1 Caenorhabditis elegans
Q58065 3.78e-14 77 25 16 392 3 MJ0649 NADH oxidase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P08662 1.57e-13 75 28 7 238 3 merA Mercuric reductase (Fragments) Serratia marcescens
P42435 3.76e-12 72 28 15 305 2 nasD Nitrite reductase [NAD(P)H] Bacillus subtilis (strain 168)
P42433 3.86e-11 68 27 12 286 2 nasB Assimilatory nitrate reductase electron transfer subunit Bacillus subtilis (strain 168)
A2RIB7 2.03e-10 66 26 14 351 1 noxE NADH oxidase Lactococcus lactis subsp. cremoris (strain MG1363)
Q5JGP4 2.73e-10 65 26 12 323 1 TK1299 NAD(P)H sulfur oxidoreductase (CoA-dependent) Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q5XC60 2.89e-10 65 25 18 375 1 M6_Spy0868 NADH oxidase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
B5XVA0 4.8e-10 64 27 6 179 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae (strain 342)
Q51973 7.12e-10 64 33 8 189 1 cmtAa p-cumate 2,3-dioxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas putida
Q31X75 3.47e-09 62 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella boydii serotype 4 (strain Sb227)
Q6D8S1 3.49e-09 62 26 5 177 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q96NN9 4.2e-09 62 28 5 189 1 AIFM3 Apoptosis-inducing factor 3 Homo sapiens
A6TCX6 4.87e-09 61 26 6 179 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2U036 6.95e-09 61 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M9E8 8.24e-09 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O8 (strain IAI1)
B7LEC2 8.24e-09 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain 55989 / EAEC)
A8A3I8 8.61e-09 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O9:H4 (strain HS)
Q3YYF3 9.17e-09 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella sonnei (strain Ss046)
Q49WB0 1.01e-08 60 29 2 141 3 cdr Coenzyme A disulfide reductase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B7N6U1 1.25e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LQ29 1.3e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SMS-3-5 / SECEC)
B5Z372 1.33e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X850 1.33e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7
P59403 1.61e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri
Q0T1D6 1.61e-08 60 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri serotype 5b (strain 8401)
B7NSJ1 2.03e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FEN4 2.2e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZQE0 2.24e-08 59 28 5 179 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R7Y9 2.34e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain UTI89 / UPEC)
A1AEQ1 2.34e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O1:K1 / APEC
B7MKI0 2.34e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MYL1 2.7e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O81 (strain ED1a)
Q0TEG9 2.74e-08 59 27 5 185 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B6I697 3e-08 59 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SE11)
Q3TY86 3.19e-08 59 25 10 252 1 Aifm3 Apoptosis-inducing factor 3 Mus musculus
P37337 3.23e-08 59 28 7 187 3 bphG Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component Paraburkholderia xenovorans (strain LB400)
P37596 3.88e-08 58 28 5 180 1 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12)
B1IUW8 3.88e-08 58 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCN8 3.88e-08 58 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / DH10B)
C4ZYV6 3.88e-08 58 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / MC4100 / BW2952)
B5F365 4.68e-08 58 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella agona (strain SL483)
B7UHC3 5.26e-08 58 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0VTB0 7.37e-08 58 27 8 207 1 rubB Rubredoxin-NAD(+) reductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5IRE8 7.37e-08 58 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH9)
A6U077 7.37e-08 58 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH1)
B7LW23 8.65e-08 57 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8NXE8 9.77e-08 57 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MW2)
Q6GAV6 9.77e-08 57 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MSSA476)
Q32CL7 9.89e-08 57 28 6 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella dysenteriae serotype 1 (strain Sd197)
Q7A6H1 1.01e-07 57 23 7 246 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain N315)
Q99VC0 1.01e-07 57 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X0I7 1.01e-07 57 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
O52582 1.55e-07 57 23 7 246 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
P42454 1.87e-07 56 31 5 138 1 rubB Rubredoxin-NAD(+) reductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9UYU5 1.91e-07 57 25 13 331 3 PYRAB14120 NAD(P)H sulfur oxidoreductase (CoA-dependent) Pyrococcus abyssi (strain GE5 / Orsay)
B5BEP9 2.18e-07 56 26 6 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi A (strain AKU_12601)
Q5PF36 2.18e-07 56 26 6 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TT18 2.43e-07 56 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella schwarzengrund (strain CVM19633)
Q07946 2.5e-07 56 28 10 224 1 bedA Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit Pseudomonas putida
Q6GIB7 2.62e-07 56 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MRSA252)
A8Z076 2.99e-07 56 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300 / TCH1516)
A6QFI1 2.99e-07 56 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Newman)
Q2FIA5 2.99e-07 56 23 7 246 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300)
A8ANR8 3.55e-07 55 28 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q5HHB4 3.97e-07 55 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain COL)
Q8U1M0 4.68e-07 55 24 9 302 1 nsr NAD(P)H sulfur oxidoreductase (CoA-dependent) Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B5QV90 6.79e-07 55 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella enteritidis PT4 (strain P125109)
Q0S032 6.84e-07 55 27 7 192 1 bphA4 Biphenyl 2,3-dioxygenase, ferredoxin reductase component Rhodococcus jostii (strain RHA1)
Q8ZMJ6 6.85e-07 55 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TF25 6.91e-07 55 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella heidelberg (strain SL476)
Q8CPT6 7.95e-07 55 21 11 337 3 cdr Coenzyme A disulfide reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQI9 7.95e-07 55 21 11 337 3 cdr Coenzyme A disulfide reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A9N0E0 8.11e-07 54 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MFX5 1.26e-06 53 25 4 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7MFY7 1.46e-06 53 23 6 178 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain YJ016)
Q8Z4C4 1.47e-06 53 26 4 177 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella typhi
B5RDG6 1.58e-06 53 26 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4T3B2 1.8e-06 53 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella newport (strain SL254)
Q8D4F7 2.03e-06 53 23 6 178 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain CMCP6)
Q8S3R2 2.11e-06 53 24 6 231 2 MDAR2 Monodehydroascorbate reductase 2, peroxisomal Oryza sativa subsp. japonica
B5FSZ2 2.17e-06 53 27 5 180 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella dublin (strain CT_02021853)
O84925 2.7e-06 53 23 15 387 1 nox NADH oxidase Streptococcus pneumoniae
A0A0H2UQZ4 2.87e-06 53 23 15 387 3 nox NADH oxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q4L4Y7 3.14e-06 53 29 4 147 3 cdr Coenzyme A disulfide reductase Staphylococcus haemolyticus (strain JCSC1435)
P80647 3.49e-06 47 48 0 47 1 None Dihydrolipoyl dehydrogenase (Fragment) Hymenolepis diminuta
Q8DP70 3.54e-06 52 23 17 438 1 nox NADH oxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A8GG95 3.61e-06 52 27 5 178 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Serratia proteamaculans (strain 568)
A0KEJ2 3.76e-06 52 26 5 181 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q84PW3 4.34e-06 52 24 5 158 2 MDAR5 Monodehydroascorbate reductase 5, chlorplastic Oryza sativa subsp. japonica
Q2YWW1 4.77e-06 52 23 7 246 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
C0PWN3 7.61e-06 51 27 4 177 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi C (strain RKS4594)
Q57KT2 7.61e-06 51 27 4 177 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella choleraesuis (strain SC-B67)
P92947 8.46e-06 52 23 5 193 1 MDAR5 Monodehydroascorbate reductase, chloroplastic/mitochondrial Arabidopsis thaliana
B5FG80 9.26e-06 51 24 6 183 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aliivibrio fischeri (strain MJ11)
Q5E3X0 1.4e-05 50 25 5 178 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4STH3 1.92e-05 50 29 4 140 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aeromonas salmonicida (strain A449)
A1A653 2.52e-05 50 25 5 177 2 fer8 Fe-regulated protein 8 Ustilago maydis (strain 521 / FGSC 9021)
A5W4E9 3.21e-05 49 28 10 221 1 todA Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P43494 6.51e-05 48 25 10 259 1 thcD Rhodocoxin reductase Rhodococcus erythropolis
Q67QU3 0.000131 47 20 12 331 3 STH965 Ferredoxin--NADP reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P08201 0.000268 47 24 9 245 3 nirB Nitrite reductase (NADH) large subunit Escherichia coli (strain K12)
O32117 0.000407 46 26 5 146 3 yutJ NADH dehydrogenase-like protein YutJ Bacillus subtilis (strain 168)
Q1JPL4 0.000421 46 27 8 154 1 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Arabidopsis thaliana
Q8VHE9 0.000595 46 51 0 43 2 Retsat All-trans-retinol 13,14-reductase Rattus norvegicus
Q64FW2 0.000666 45 51 0 43 1 Retsat All-trans-retinol 13,14-reductase Mus musculus
Q03JS2 0.000693 45 23 12 347 3 STER_1382 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M3J6 0.000693 45 23 12 347 3 stu1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYY3 0.000693 45 23 12 347 3 str1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain CNRZ 1066)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16030
Feature type CDS
Gene sthA
Product Si-specific NAD(P)(+) transhydrogenase
Location 3562641 - 3564038 (strand: -1)
Length 1398 (nucleotides) / 465 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1742
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02852 Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
PF07992 Pyridine nucleotide-disulphide oxidoreductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1249 Energy production and conversion (C) C Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00322 NAD(P) transhydrogenase [EC:1.6.1.1] Nicotinate and nicotinamide metabolism
Metabolic pathways		 -

Protein Sequence

MQHSHFDAIVIGSGPGGEGAAMGLVKQGKRVAVIERYDQVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDQSRLINSSFSQILRQASTVISQQTKMRQGFYERNHCTMYSGEAAFIDDHRISVRYPDGTCDILSADNFIIATGSRPYCPPDVDFSHSRIYNSDTILDLEHEPRHVIIYGAGVIGCEYASIFRGLRVKVDLINTRDHLLSFLDQEMSDALSYHFWNNGIVIRHNEEYDTIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDTLGLENVGIKTDSRGQVAVNAHYQTSCEHIYAVGDVIGYPSLASAAYDQGRIAALALTTGTSETHLIEDIPTGIYTIPEISSVGKTEQQLTAMKIPYEVGRSQFKHLARAQIAGMNVGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

Flanking regions ( +/- flanking 50bp)

TTCTAATGTTAATATGTCGTTGTCGTTTTGTATAAAACAGGTCTCTTCCTATGCAACATTCTCATTTCGATGCAATTGTAATCGGTTCAGGTCCTGGTGGTGAAGGCGCGGCCATGGGGCTGGTTAAACAAGGAAAACGCGTCGCCGTCATTGAACGTTATGATCAAGTCGGTGGTGGTTGTACTCACTGGGGAACTATCCCTTCAAAAGCTCTACGCCACGCGGTCAGTCGTATTATCGAGTTTAATCAAAACCCGCTCTATAGCGACCAATCTCGCCTGATCAACTCCTCTTTTTCTCAAATACTACGCCAAGCCAGCACGGTAATCAGTCAACAGACTAAAATGCGTCAAGGCTTCTACGAGCGTAATCATTGTACGATGTATTCAGGCGAAGCTGCTTTTATTGATGATCATAGAATTAGCGTACGTTATCCTGATGGTACTTGTGATATTCTCAGTGCAGATAATTTTATTATTGCCACAGGCTCTCGCCCTTATTGCCCACCGGATGTTGATTTCTCACACTCTCGTATTTATAACAGCGATACCATACTCGACCTTGAGCATGAACCTCGCCATGTCATTATTTATGGTGCTGGGGTCATTGGTTGTGAATACGCTTCTATTTTTAGAGGTCTAAGAGTAAAAGTTGATTTAATTAATACTCGTGATCATCTACTGTCATTCCTTGATCAAGAAATGTCAGATGCACTCTCTTACCATTTTTGGAATAACGGTATTGTTATTCGACACAATGAAGAGTACGACACCATCGAAGGCGTTGATGATGGCGTTATTGTTCATCTAAAATCCGGTAAGAAAGTCAAAGCCGATTGTCTGCTTTATGCTAATGGTAGAACGGGTAATACCGATACGCTTGGTTTAGAAAATGTTGGGATCAAAACCGATAGCCGTGGACAAGTGGCAGTTAATGCGCATTATCAAACCAGTTGTGAACATATCTATGCAGTAGGTGATGTGATTGGCTATCCAAGCTTAGCCTCTGCGGCTTATGATCAAGGGCGCATTGCGGCACTTGCGCTTACCACAGGCACCTCGGAAACGCATTTAATTGAAGATATTCCAACGGGTATCTATACCATTCCAGAAATCAGCTCTGTGGGTAAAACGGAACAGCAACTCACCGCAATGAAGATCCCCTATGAGGTCGGTCGTTCACAATTTAAGCATCTTGCTAGAGCCCAAATTGCGGGTATGAATGTCGGTAGCTTAAAAATTCTTTTTCACCGTGAAACCAAGCAAATTTTAGGTATTCACTGCTTTGGCGAGCGCGCTGCTGAAATAATTCATATCGGACAAGCAATTATGGAGCAGAAAGGAGAAGGCAATACTATCGAATACTTCGTTAATACCACCTTCAACTATCCAACCATGGCGGAAGCCTATCGCGTTGCTGCTTTAAATGGTTTAAATCGCTTATTTTGATGTTGCTTTCTTAGCCTCATAAAATGCGGTCATATGATCACGGATTGTCT