Homologs in group_4781

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4781

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4781

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F181 9.3e-122 343 100 0 172 3 PMI3225 UPF0114 protein PMI3225 Proteus mirabilis (strain HI4320)
A6TDZ7 3.73e-83 245 70 0 161 3 KPN78578_33570 UPF0114 protein KPN78578_33570 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WEE1 4.26e-82 243 70 0 164 3 Ent638_3411 UPF0114 protein Ent638_3411 Enterobacter sp. (strain 638)
B5XU71 8.48e-82 241 70 0 161 3 KPK_0696 UPF0114 protein KPK_0696 Klebsiella pneumoniae (strain 342)
B7V0B7 6.36e-81 239 68 0 162 3 PLES_49571 UPF0114 protein PLES_49571 Pseudomonas aeruginosa (strain LESB58)
Q9HVL0 6.36e-81 239 68 0 162 3 PA4574 UPF0114 protein PA4574 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02GA3 2.67e-80 238 67 0 162 3 PA14_60530 UPF0114 protein PA14_60530 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VBW1 2.67e-80 238 67 0 162 3 PSPA7_5214 UPF0114 protein PSPA7_5214 Pseudomonas aeruginosa (strain PA7)
A7MNC8 3.66e-78 233 71 1 164 3 ESA_00283 UPF0114 protein ESA_00283 Cronobacter sakazakii (strain ATCC BAA-894)
A8GEE7 1.81e-77 231 71 0 164 3 Spro_2386 UPF0114 protein Spro_2386 Serratia proteamaculans (strain 568)
Q8ZM13 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TVN6 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella schwarzengrund (strain CVM19633)
B5BFW5 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella paratyphi A (strain AKU_12601)
C0PYD4 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella paratyphi C (strain RKS4594)
A9N4W6 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PMS0 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5R6 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella newport (strain SL254)
B4TI02 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella heidelberg (strain SL476)
B5REB2 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYC8 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella enteritidis PT4 (strain P125109)
Q57JW1 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella choleraesuis (strain SC-B67)
B5F641 9.45e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella agona (strain SL483)
B5FV19 9.55e-76 226 67 0 164 3 yqhA UPF0114 protein YqhA Salmonella dublin (strain CT_02021853)
Q8Z3Q8 2.06e-75 226 67 0 164 3 STY3326 UPF0114 protein YqhA Salmonella typhi
C1DEB0 7.17e-75 224 64 0 164 3 Avin_40830 UPF0114 protein Avin_40830 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3YXN2 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Shigella sonnei (strain Ss046)
Q31WQ2 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Shigella boydii serotype 4 (strain Sb227)
B2U1A7 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LPX2 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LEY8 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain SMS-3-5 / SECEC)
B6I7F4 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain SE11)
B7NCZ3 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67244 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain K12)
B1ISF1 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FDL6 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDA9 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFR5 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O1:K1 / APEC
A8A4G1 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O9:H4 (strain HS)
B1XFF6 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain K12 / DH10B)
C4ZQS4 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZF6 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O8 (strain IAI1)
B7MZZ0 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O81 (strain ED1a)
B7NJ05 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR48 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67245 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O157:H7
B7LGE9 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli (strain 55989 / EAEC)
B7MA67 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIQ5 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRN9 3.87e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32C68 3.91e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Shigella dysenteriae serotype 1 (strain Sd197)
Q7UBK4 5.38e-74 222 66 0 164 3 yqhA UPF0114 protein YqhA Shigella flexneri
C6DJS4 1.03e-72 219 68 0 164 3 PC1_0431 UPF0114 protein PC1_0431 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A3D0P2 5.23e-72 217 61 0 164 3 Sbal_0780 UPF0114 protein Sbal_0780 Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q12S48 7.42e-72 216 62 0 162 3 Sden_0436 UPF0114 protein Sden_0436 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q07WY2 1.7e-71 216 62 0 162 3 Sfri_3655 UPF0114 protein Sfri_3655 Shewanella frigidimarina (strain NCIMB 400)
A9L382 4.28e-71 214 60 0 164 3 Sbal195_3851 UPF0114 protein Sbal195_3851 Shewanella baltica (strain OS195)
A6WSR0 4.28e-71 214 60 0 164 3 Shew185_3725 UPF0114 protein Shew185_3725 Shewanella baltica (strain OS185)
B8EB95 4.28e-71 214 60 0 164 3 Sbal223_3668 UPF0114 protein Sbal223_3668 Shewanella baltica (strain OS223)
Q1IF21 3.68e-69 209 66 0 162 3 PSEEN0819 UPF0114 protein PSEEN0819 Pseudomonas entomophila (strain L48)
A4VI46 6.72e-69 209 64 0 162 3 PST_0950 UPF0114 protein PST_0950 Stutzerimonas stutzeri (strain A1501)
B1JF19 6.72e-69 209 66 0 162 3 PputW619_4503 UPF0114 protein PputW619_4503 Pseudomonas putida (strain W619)
A5VYB7 1.31e-68 208 66 0 162 3 Pput_0713 UPF0114 protein Pput_0713 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88Q16 1.31e-68 208 66 0 162 3 PP_0682 UPF0114 protein PP_0682 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KME8 1.32e-68 208 66 0 162 3 PputGB1_0714 UPF0114 protein PputGB1_0714 Pseudomonas putida (strain GB-1)
Q4ZNI5 4.37e-68 207 65 0 162 3 Psyr_4257 UPF0114 protein Psyr_4257 Pseudomonas syringae pv. syringae (strain B728a)
Q87WG7 8.8e-68 206 65 0 162 3 PSPTO_4583 UPF0114 protein PSPTO_4583 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A5F419 1.8e-66 203 61 0 162 3 VC0395_A2587 UPF0114 protein VC0395_A2587/VC395_0240 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KVD8 1.8e-66 203 61 0 162 3 VC_0208 UPF0114 protein VC_0208 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LQH1 1.8e-66 203 61 0 162 3 VCM66_0196 UPF0114 protein VCM66_0196 Vibrio cholerae serotype O1 (strain M66-2)
Q9ZEZ0 7.15e-66 201 58 0 162 3 BUpL02 UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O31289 1.22e-65 201 59 0 162 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Thelaxes suberi
Q8EAB0 1.56e-65 200 61 0 162 3 SO_3997 UPF0114 protein SO_3997 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HMJ1 1.88e-65 200 61 0 162 3 Shewmr4_0646 UPF0114 protein Shewmr4_0646 Shewanella sp. (strain MR-4)
A0KSW3 1.88e-65 200 61 0 162 3 Shewana3_0644 UPF0114 protein Shewana3_0644 Shewanella sp. (strain ANA-3)
Q0HR97 1.88e-65 200 61 0 162 3 Shewmr7_3376 UPF0114 protein Shewmr7_3376 Shewanella sp. (strain MR-7)
Q1LU52 3.1e-65 200 57 0 161 3 BCI_0033 UPF0114 protein BCI_0033 Baumannia cicadellinicola subsp. Homalodisca coagulata
C3K2C1 3.39e-65 199 62 0 162 3 PFLU_5318 UPF0114 protein PFLU_5318 Pseudomonas fluorescens (strain SBW25)
O85068 3.49e-65 200 58 0 162 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Diuraphis noxia
Q9F4E2 3.78e-65 199 58 0 163 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Geoica urticularia
O85061 5.01e-65 199 58 0 162 3 BUsg_PL2 UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89B48 1.1e-64 198 58 0 162 3 bbp_601 UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q53016 1.26e-64 198 59 1 162 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Rhopalosiphum padi
A4Y370 5.51e-64 196 59 0 162 3 Sputcn32_0673 UPF0114 protein Sputcn32_0673 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RNR8 5.51e-64 196 59 0 162 3 Sputw3181_3501 UPF0114 protein Sputw3181_3501 Shewanella sp. (strain W3-18-1)
Q9ZEZ4 1.19e-61 191 59 0 157 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Pterocomma populeum
O31285 2.21e-57 180 57 1 161 3 None UPF0114 protein in repA1-repA2 intergenic region Buchnera aphidicola subsp. Tetraneura caerulescens
C4LES1 7.41e-49 158 59 0 159 3 Tola_1474 UPF0114 protein Tola_1474 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
O24989 1.99e-30 112 35 3 177 3 HP_0189 UPF0114 protein HP_0189 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZMP3 3.38e-30 111 35 3 177 3 jhp_0175 UPF0114 protein jhp_0175 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CUX2 1.16e-29 110 35 3 177 3 HPAG1_0183 UPF0114 protein HPAG1_0183 Helicobacter pylori (strain HPAG1)
B5Z9W0 1.16e-29 110 35 3 177 3 HPG27_173 UPF0114 protein HPG27_173 Helicobacter pylori (strain G27)
B2US19 1.34e-29 109 36 3 170 3 HPSH_00970 UPF0114 protein HPSH_00970 Helicobacter pylori (strain Shi470)
B6JPT9 2.21e-29 109 35 3 177 3 HPP12_0190 UPF0114 protein HPP12_0190 Helicobacter pylori (strain P12)
Q4QN39 2.41e-28 106 34 0 158 3 NTHI0635 UPF0114 protein NTHI0635 Haemophilus influenzae (strain 86-028NP)
P44010 2.41e-28 106 34 0 158 3 HI_0507 UPF0114 protein HI_0507 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5U9Y4 2.41e-28 106 34 0 158 3 CGSHiEE_00455 UPF0114 protein CGSHiEE_00455 Haemophilus influenzae (strain PittEE)
A5UH14 2.08e-27 104 34 0 158 3 CGSHiGG_05795 UPF0114 protein CGSHiGG_05795 Haemophilus influenzae (strain PittGG)
P57929 8.8e-27 103 37 2 158 3 PM1258 UPF0114 protein PM1258 Pasteurella multocida (strain Pm70)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15950
Feature type CDS
Gene -
Product TIGR00645 family protein
Location 3541107 - 3541625 (strand: 1)
Length 519 (nucleotides) / 172 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4781
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF03350 Uncharacterized protein family, UPF0114

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2862 Function unknown (S) S Uncharacterized membrane protein YqhA

Protein Sequence

MNRIVEKWMYRSRWLFAPVYIGLSLGLLALTIKFFQSMYEILPNIFALSEADLVLRLLSLIDLALVGGLLIMVIFSGYENFITNMEIEGAKDKLSWLGNMDAESLKNKVAASIVAISSIHLLGVFMDLKNIPDNKLLWYVVLHLTFVFSAFVMGYLEKISKRSKRANKANQG

Flanking regions ( +/- flanking 50bp)

TCTTCTATACTGAAAAAGATGATGATTAATTGTGTAGATAGAGAGGAAATATGAATAGAATTGTTGAAAAATGGATGTATCGCTCTCGTTGGTTATTTGCACCTGTCTATATTGGCTTATCTCTTGGATTGTTGGCATTAACGATTAAGTTTTTTCAGTCAATGTACGAGATCTTACCCAATATATTTGCCTTATCTGAAGCTGATTTAGTTTTACGTTTATTATCGCTAATTGATTTGGCATTAGTGGGGGGGTTATTGATAATGGTTATTTTCTCAGGTTATGAGAATTTTATTACCAATATGGAAATCGAAGGCGCGAAGGATAAACTCTCTTGGTTAGGTAACATGGATGCAGAATCGCTGAAAAATAAAGTTGCTGCTTCTATTGTTGCTATCTCTTCTATTCATTTGTTAGGGGTGTTTATGGACTTAAAAAATATCCCCGATAACAAGTTATTATGGTATGTGGTGCTACATCTGACTTTTGTTTTTTCCGCTTTTGTGATGGGCTATTTAGAGAAGATCTCTAAACGAAGTAAGCGAGCAAATAAAGCCAATCAAGGGTGATAAAATGAGAGCTACAGCACGTCGTTATTTTTAACCTTGGCTATACTTAG