Homologs in group_2159

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16245 FBDBKF_16245 94.9 Morganella morganii S1 rpmB 50S ribosomal protein L28
EHELCC_16280 EHELCC_16280 94.9 Morganella morganii S2 rpmB 50S ribosomal protein L28
NLDBIP_17060 NLDBIP_17060 94.9 Morganella morganii S4 rpmB 50S ribosomal protein L28
LHKJJB_16980 LHKJJB_16980 94.9 Morganella morganii S3 rpmB 50S ribosomal protein L28
HKOGLL_16860 HKOGLL_16860 94.9 Morganella morganii S5 rpmB 50S ribosomal protein L28
F4V73_RS17350 F4V73_RS17350 93.6 Morganella psychrotolerans rpmB 50S ribosomal protein L28

Distribution of the homologs in the orthogroup group_2159

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2159

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0W9 7.27e-53 161 100 0 78 3 rpmB Large ribosomal subunit protein bL28 Proteus mirabilis (strain HI4320)
C6DIC0 2.29e-51 157 96 0 78 3 rpmB Large ribosomal subunit protein bL28 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5B9D6 2.29e-51 157 96 0 78 3 rpmB Large ribosomal subunit protein bL28 Edwardsiella ictaluri (strain 93-146)
B2VF68 2.82e-51 157 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GLE4 3.32e-51 157 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Serratia proteamaculans (strain 568)
Q3YVZ9 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Shigella sonnei (strain Ss046)
P0A7M5 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Shigella flexneri
Q329M0 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Shigella dysenteriae serotype 1 (strain Sd197)
B2TTV1 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TFM8 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LVJ8 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4V5 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain UTI89 / UPEC)
B1LK74 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain SMS-3-5 / SECEC)
B6I3L4 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain SE11)
B7NEU1 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7M2 6.28e-51 156 94 0 78 1 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain K12)
B1IZF6 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7M3 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBH2 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A699 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O9:H4 (strain HS)
B1X971 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain K12 / DH10B)
C4ZXM9 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4C1 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O8 (strain IAI1)
B7N277 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O81 (strain ED1a)
B7NPZ8 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWD5 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7M4 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O157:H7
B7L760 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli (strain 55989 / EAEC)
B7MFJ8 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULJ2 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTI8 6.28e-51 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A2A5 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A6 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella typhi
B4TZX9 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella schwarzengrund (strain CVM19633)
B5BI11 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella paratyphi A (strain AKU_12601)
C0Q1X0 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella paratyphi C (strain RKS4594)
Q5PC31 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXD9 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella newport (strain SL254)
B4T9C2 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella heidelberg (strain SL476)
B5RGF0 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5G1 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella enteritidis PT4 (strain P125109)
B5FM61 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella dublin (strain CT_02021853)
Q57IA5 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella choleraesuis (strain SC-B67)
B5EXE2 8.18e-51 156 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Salmonella agona (strain SL483)
Q6DAV6 1.01e-50 156 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JHR2 1.8e-50 155 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5XTG6 1.95e-50 155 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Klebsiella pneumoniae (strain 342)
A4W512 1.95e-50 155 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Enterobacter sp. (strain 638)
Q2NQU2 2.96e-50 155 94 0 78 3 rpmB Large ribosomal subunit protein bL28 Sodalis glossinidius (strain morsitans)
Q31UY9 4.34e-50 154 93 0 78 3 rpmB Large ribosomal subunit protein bL28 Shigella boydii serotype 4 (strain Sb227)
B1JQX2 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66GD5 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSD6 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pestis (strain Pestoides F)
Q1CD03 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R675 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJP2 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pestis
B2JYN4 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C268 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCT5 5.29e-50 154 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MY29 2.11e-49 152 92 0 78 3 rpmB Large ribosomal subunit protein bL28 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9CLR1 2.62e-47 147 87 0 77 3 rpmB Large ribosomal subunit protein bL28 Pasteurella multocida (strain Pm70)
B8F858 2.33e-46 145 85 0 77 3 rpmB Large ribosomal subunit protein bL28 Glaesserella parasuis serovar 5 (strain SH0165)
Q65R61 2.94e-46 145 85 0 77 3 rpmB Large ribosomal subunit protein bL28 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VK99 2.94e-46 145 85 0 77 3 rpmB Large ribosomal subunit protein bL28 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UUW8 4.66e-46 144 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Histophilus somni (strain 2336)
Q0I0X8 4.66e-46 144 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Histophilus somni (strain 129Pt)
B0BTZ6 1.56e-45 143 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H341 1.56e-45 143 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3Q9 1.56e-45 143 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MSP8 1.63e-45 143 86 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio campbellii (strain ATCC BAA-1116)
P44364 2.85e-45 142 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI93 2.85e-45 142 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Haemophilus influenzae (strain PittGG)
A5UDB7 2.85e-45 142 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Haemophilus influenzae (strain PittEE)
Q4QLV6 2.85e-45 142 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Haemophilus influenzae (strain 86-028NP)
Q87T85 4.14e-45 142 85 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4K7G0 5.69e-45 141 80 0 78 3 rpmB Large ribosomal subunit protein bL28 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7VN52 9.54e-45 141 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B5FFF7 1.39e-44 140 85 0 76 3 rpmB Large ribosomal subunit protein bL28 Aliivibrio fischeri (strain MJ11)
Q5E8M4 1.39e-44 140 85 0 76 3 rpmB Large ribosomal subunit protein bL28 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B7VHK3 2.8e-44 140 84 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio atlanticus (strain LGP32)
A1U6L5 4.2e-44 139 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B4S2C3 1.62e-43 138 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A0KEM9 1.98e-43 137 84 0 77 3 rpmB Large ribosomal subunit protein bL28 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7MPS6 2.09e-43 137 84 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio vulnificus (strain YJ016)
Q8DDY1 2.09e-43 137 84 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio vulnificus (strain CMCP6)
C4L813 2.49e-43 137 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q6LVN3 3.61e-43 137 82 0 76 3 rpmB Large ribosomal subunit protein bL28 Photobacterium profundum (strain SS9)
Q21EE5 6.19e-43 136 81 0 77 3 rpmB Large ribosomal subunit protein bL28 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9HTN8 6.83e-43 136 83 0 78 1 rpmB Large ribosomal subunit protein bL28 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02E46 6.83e-43 136 83 0 78 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5K7 6.83e-43 136 83 0 78 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas aeruginosa (strain LESB58)
A6VEC3 6.83e-43 136 83 0 78 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas aeruginosa (strain PA7)
A1S2D3 1.03e-42 135 81 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4STD4 1.21e-42 135 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Aeromonas salmonicida (strain A449)
B0TQL2 1.51e-42 135 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella halifaxensis (strain HAW-EB4)
C3LQI0 1.74e-42 135 81 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio cholerae serotype O1 (strain M66-2)
Q9KVC8 1.74e-42 135 81 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F404 1.74e-42 135 81 0 76 3 rpmB Large ribosomal subunit protein bL28 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C5BLG3 1.74e-42 135 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B6EPP2 2.85e-42 135 81 0 76 3 rpmB Large ribosomal subunit protein bL28 Aliivibrio salmonicida (strain LFI1238)
B8CM30 4.67e-42 134 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H9A9 4.82e-42 134 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QIP8 5.32e-42 134 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8GUR2 5.75e-42 134 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0A5A6 5.75e-42 134 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B1KL04 1.27e-41 133 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella woodyi (strain ATCC 51908 / MS32)
Q5QZB3 1.92e-41 132 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B3PG61 2.59e-41 132 77 0 77 3 rpmB Large ribosomal subunit protein bL28 Cellvibrio japonicus (strain Ueda107)
A8FQ76 3.72e-41 132 77 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella sediminis (strain HAW-EB3)
A1REU5 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella sp. (strain W3-18-1)
Q0HZU2 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella sp. (strain MR-7)
Q0HE57 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella sp. (strain MR-4)
A0L1R8 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella sp. (strain ANA-3)
A4Y2L2 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8E9M3 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KY05 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella baltica (strain OS195)
A6WIA7 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella baltica (strain OS185)
A3CZJ7 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4J6 5.34e-41 131 79 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella baltica (strain OS223)
A4VFR3 8.85e-41 131 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Stutzerimonas stutzeri (strain A1501)
A4Y0K5 8.85e-41 131 83 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas mendocina (strain ymp)
B1J4M3 1.24e-40 130 80 0 78 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas putida (strain W619)
C1DK04 1.43e-40 130 81 0 77 3 rpmB Large ribosomal subunit protein bL28 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5WD03 1.71e-40 130 80 0 77 3 rpmB Large ribosomal subunit protein bL28 Psychrobacter sp. (strain PRwf-1)
Q48AD7 4.07e-40 129 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A4IWH7 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NEM3 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BN37 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4S4 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. novicida (strain U112)
B2SFK9 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A4R1 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. holarctica (strain LVS)
A7NAM4 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14G26 5.35e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella tularensis subsp. tularensis (strain FSC 198)
Q07WG2 6.67e-40 129 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Shewanella frigidimarina (strain NCIMB 400)
A1SR14 7.28e-40 129 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1Q987 1.32e-39 128 77 0 77 3 rpmB Large ribosomal subunit protein bL28 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FR00 1.32e-39 128 77 0 77 3 rpmB Large ribosomal subunit protein bL28 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1LTS4 1.66e-39 127 79 0 74 3 rpmB Large ribosomal subunit protein bL28 Baumannia cicadellinicola subsp. Homalodisca coagulata
A6VSY4 1.91e-39 127 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Marinomonas sp. (strain MWYL1)
Q1QT92 2.26e-39 127 74 0 77 3 rpmB Large ribosomal subunit protein bL28 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2SN70 2.38e-39 127 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Hahella chejuensis (strain KCTC 2396)
A1WZG5 2.66e-39 127 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Halorhodospira halophila (strain DSM 244 / SL1)
Q15ZV8 3.24e-39 127 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0V4N1 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain AYE)
A3M1V9 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VL79 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain SDF)
B2I392 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain ACICU)
B7I4T0 7.97e-39 126 76 0 77 1 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain AB0057)
B7H0Q4 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baumannii (strain AB307-0294)
Q6FES9 7.97e-39 126 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0U0F9 9.2e-39 126 71 0 77 3 rpmB Large ribosomal subunit protein bL28 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0VT57 3.01e-38 124 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3J7V3 3.55e-38 124 74 0 77 3 rpmB Large ribosomal subunit protein bL28 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q88C99 4.28e-38 124 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KQ85 4.28e-38 124 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas putida (strain GB-1)
A5WB00 4.28e-38 124 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5EWV8 1.11e-37 123 71 0 77 3 rpmB Large ribosomal subunit protein bL28 Dichelobacter nodosus (strain VCS1703A)
A9HWU4 2.19e-37 122 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1AXP3 2.24e-37 122 71 0 77 3 rpmB Large ribosomal subunit protein bL28 Ruthia magnifica subsp. Calyptogena magnifica
Q1I2U5 3.48e-37 122 75 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas entomophila (strain L48)
Q31EB5 3.68e-37 122 71 0 77 3 rpmB Large ribosomal subunit protein bL28 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q4K3S6 3.76e-37 122 76 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZZX5 4.21e-37 122 77 0 76 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas syringae pv. syringae (strain B728a)
Q88BC8 4.21e-37 122 77 0 76 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48Q02 4.21e-37 122 77 0 76 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2T6H7 4.35e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
C3K469 5.48e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas fluorescens (strain SBW25)
B5ENA7 8.1e-37 121 74 0 77 3 rpmB Large ribosomal subunit protein bL28 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7Y4 8.1e-37 121 74 0 77 3 rpmB Large ribosomal subunit protein bL28 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B2JDZ9 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JH22 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2T0G3 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63WH3 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia pseudomallei (strain K96243)
A3N6Q8 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia pseudomallei (strain 668)
Q3JV54 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia pseudomallei (strain 1710b)
A3NSE3 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia pseudomallei (strain 1106a)
Q1BUB1 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia orbicola (strain AU 1054)
B1JXB3 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia orbicola (strain MC0-3)
Q62HM5 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia mallei (strain ATCC 23344)
A2S4Y9 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia mallei (strain NCTC 10229)
A9AHD5 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39DN8 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BCL8 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E8Y7 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K9S5 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia cenocepacia (strain HI2424)
B1YV94 8.51e-37 121 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Burkholderia ambifaria (strain MC40-6)
Q8XWM9 1.79e-36 120 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3K4N0 2.85e-36 119 76 0 76 3 rpmB Large ribosomal subunit protein bL28 Pseudomonas fluorescens (strain Pf0-1)
A5CVN4 3.5e-36 119 71 0 76 3 rpmB Large ribosomal subunit protein bL28 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7VWY1 4.9e-36 119 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W9L9 4.9e-36 119 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WH39 4.9e-36 119 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KXH8 4.9e-36 119 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Bordetella avium (strain 197N)
B2UAP1 8.91e-36 118 73 0 76 3 rpmB Large ribosomal subunit protein bL28 Ralstonia pickettii (strain 12J)
Q13UX2 1.49e-35 117 73 0 76 3 rpmB Large ribosomal subunit protein bL28 Paraburkholderia xenovorans (strain LB400)
B3R6F8 1.54e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46XN9 1.54e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K7B2 1.54e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5WZ62 2.54e-35 117 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Legionella pneumophila (strain Lens)
Q5ZY93 2.54e-35 117 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHB6 2.54e-35 117 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Legionella pneumophila (strain Corby)
Q5X7R1 2.54e-35 117 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Legionella pneumophila (strain Paris)
A1KVW2 2.73e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66151 2.73e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66150 2.73e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M300 2.73e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Neisseria meningitidis serogroup C (strain 053442)
Q5F682 2.73e-35 117 75 0 76 3 rpmB Large ribosomal subunit protein bL28 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A4SZN3 3.96e-35 117 68 0 76 3 rpmB Large ribosomal subunit protein bL28 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q1LJD3 4.01e-35 117 73 0 76 3 rpmB Large ribosomal subunit protein bL28 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9BNU9 1.23e-34 115 71 0 76 3 rpmB Large ribosomal subunit protein bL28 Delftia acidovorans (strain DSM 14801 / SPH-1)
B1XW20 1.43e-34 115 67 0 76 3 rpmB Large ribosomal subunit protein bL28 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q1H4K4 1.76e-34 115 67 0 77 3 rpmB Large ribosomal subunit protein bL28 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B2FNE3 1.81e-34 115 72 0 77 3 rpmB Large ribosomal subunit protein bL28 Stenotrophomonas maltophilia (strain K279a)
B4SNN0 1.81e-34 115 72 0 77 3 rpmB Large ribosomal subunit protein bL28 Stenotrophomonas maltophilia (strain R551-3)
Q125U2 2.15e-34 115 68 0 76 3 rpmB Large ribosomal subunit protein bL28 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1TSP7 2.4e-34 115 71 0 76 3 rpmB Large ribosomal subunit protein bL28 Paracidovorax citrulli (strain AAC00-1)
A1WB79 2.56e-34 114 69 0 76 3 rpmB Large ribosomal subunit protein bL28 Acidovorax sp. (strain JS42)
B9MEB7 2.56e-34 114 69 0 76 3 rpmB Large ribosomal subunit protein bL28 Acidovorax ebreus (strain TPSY)
Q47BA8 2.71e-34 114 72 0 76 3 rpmB Large ribosomal subunit protein bL28 Dechloromonas aromatica (strain RCB)
Q3SFR4 7.64e-34 113 72 0 76 3 rpmB Large ribosomal subunit protein bL28 Thiobacillus denitrificans (strain ATCC 25259)
Q82UL8 7.89e-34 113 66 0 77 3 rpmB Large ribosomal subunit protein bL28 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C1DCC0 1.01e-33 113 71 0 76 3 rpmB Large ribosomal subunit protein bL28 Laribacter hongkongensis (strain HLHK9)
Q7NSH0 1.27e-33 113 71 0 76 3 rpmB Large ribosomal subunit protein bL28 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B1Y149 1.77e-33 112 69 0 76 3 rpmB Large ribosomal subunit protein bL28 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1VS84 1.83e-33 112 68 0 76 3 rpmB Large ribosomal subunit protein bL28 Polaromonas naphthalenivorans (strain CJ2)
Q491X0 3.81e-33 111 70 0 71 3 rpmB Large ribosomal subunit protein bL28 Blochmanniella pennsylvanica (strain BPEN)
A1WIQ4 4.49e-33 111 67 0 76 3 rpmB Large ribosomal subunit protein bL28 Verminephrobacter eiseniae (strain EF01-2)
Q2NXC7 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BMM5 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66161 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RYR3 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas campestris pv. campestris (strain B100)
Q4UP61 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas campestris pv. campestris (strain 8004)
P66160 5.51e-33 111 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xanthomonas axonopodis pv. citri (strain 306)
C5CRK1 7.95e-33 111 68 0 76 3 rpmB Large ribosomal subunit protein bL28 Variovorax paradoxus (strain S110)
A4G7W0 1.02e-32 110 68 0 77 3 rpmB Large ribosomal subunit protein bL28 Herminiimonas arsenicoxydans
P66163 1.31e-32 110 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5P7 1.31e-32 110 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xylella fastidiosa (strain M12)
P66162 1.31e-32 110 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xylella fastidiosa (strain 9a5c)
B2I8L7 1.31e-32 110 70 0 77 3 rpmB Large ribosomal subunit protein bL28 Xylella fastidiosa (strain M23)
Q5P1Z7 1.4e-32 110 67 0 77 3 rpmB Large ribosomal subunit protein bL28 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8D2F1 1.95e-32 110 56 0 74 3 rpmB Large ribosomal subunit protein bL28 Wigglesworthia glossinidia brevipalpis
Q0AHY1 2.03e-32 110 64 0 77 3 rpmB Large ribosomal subunit protein bL28 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q89AY8 6.08e-32 108 68 0 67 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8D6Z4 7.7e-32 108 69 0 68 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8P0 7.7e-32 108 69 0 68 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q21TL4 1.57e-31 107 65 0 76 3 rpmB Large ribosomal subunit protein bL28 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A2SET9 1.77e-31 107 65 0 76 3 rpmB Large ribosomal subunit protein bL28 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7VRK1 2.34e-31 107 57 0 77 3 rpmB Large ribosomal subunit protein bL28 Blochmanniella floridana
A1K4J8 4.44e-31 106 64 0 77 3 rpmB Large ribosomal subunit protein bL28 Azoarcus sp. (strain BH72)
Q605E5 4.58e-31 106 67 0 77 3 rpmB Large ribosomal subunit protein bL28 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P57188 5.86e-31 106 67 0 68 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA33 1.67e-30 105 63 0 71 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2Y739 4.02e-30 104 62 0 74 3 rpmB Large ribosomal subunit protein bL28 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q83EM4 3.08e-29 102 64 0 74 3 rpmB Large ribosomal subunit protein bL28 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB26 3.08e-29 102 64 0 74 3 rpmB Large ribosomal subunit protein bL28 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGS7 3.08e-29 102 64 0 74 3 rpmB Large ribosomal subunit protein bL28 Coxiella burnetii (strain Dugway 5J108-111)
B6J213 3.08e-29 102 64 0 74 3 rpmB Large ribosomal subunit protein bL28 Coxiella burnetii (strain CbuG_Q212)
B6J5S6 3.08e-29 102 64 0 74 3 rpmB Large ribosomal subunit protein bL28 Coxiella burnetii (strain CbuK_Q154)
C3PF15 1.7e-23 87 53 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B3EMT2 1.92e-23 87 55 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobium phaeobacteroides (strain BS1)
Q6NIC6 3.95e-23 86 53 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6ABY4 2.43e-22 84 54 0 77 3 rpmB Large ribosomal subunit protein bL28 Leifsonia xyli subsp. xyli (strain CTCB07)
Q8NS15 2.51e-22 84 53 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCL1 2.51e-22 84 53 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium glutamicum (strain R)
C4LHF3 4.59e-22 84 53 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B3QM42 5.15e-22 83 52 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B4SE11 7.9e-22 83 51 0 72 3 rpmB Large ribosomal subunit protein bL28 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q4JTZ9 1e-21 83 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium jeikeium (strain K411)
B1VFG3 1.01e-21 83 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B3EH36 1.09e-21 82 52 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A0M3L4 1.37e-21 82 50 0 75 3 rpmB Large ribosomal subunit protein bL28 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q11XD1 2.53e-21 82 49 0 75 3 rpmB Large ribosomal subunit protein bL28 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q93SU8 4.71e-21 81 50 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B2GG84 5.29e-21 81 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A5F9Z1 7.43e-21 80 50 0 75 3 rpmB Large ribosomal subunit protein bL28 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q8FR24 8.29e-21 80 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q3APT1 1e-20 80 53 0 63 3 rpmB Large ribosomal subunit protein bL28 Chlorobium chlorochromatii (strain CaD3)
A1BE11 1.11e-20 80 50 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A6GZI6 1.14e-20 80 49 0 75 3 rpmB Large ribosomal subunit protein bL28 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q5YPR4 2.25e-20 79 51 0 77 3 rpmB2 Large ribosomal subunit protein bL28B Nocardia farcinica (strain IFM 10152)
A1RB24 4.28e-20 79 50 0 77 3 rpmB Large ribosomal subunit protein bL28 Paenarthrobacter aurescens (strain TC1)
B0RDL1 5.63e-20 78 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Clavibacter sepedonicus
A5CV85 5.63e-20 78 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C5C6R3 9.12e-20 78 50 0 77 3 rpmB Large ribosomal subunit protein bL28 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q9X8K8 1.2e-19 77 49 0 75 3 rpmB2 Large ribosomal subunit protein bL28B Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6A5U8 1.34e-19 77 48 0 77 3 rpmB Large ribosomal subunit protein bL28 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A4SFZ8 1.64e-19 77 55 0 63 3 rpmB Large ribosomal subunit protein bL28 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3ERW9 1.67e-19 77 49 0 75 3 rpmB Large ribosomal subunit protein bL28 Amoebophilus asiaticus (strain 5a2)
B8H776 1.96e-19 77 49 0 77 3 rpmB Large ribosomal subunit protein bL28 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
B4S5K3 3.99e-19 76 52 0 63 3 rpmB Large ribosomal subunit protein bL28 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A0K1X6 7.89e-19 75 49 0 77 3 rpmB Large ribosomal subunit protein bL28 Arthrobacter sp. (strain FB24)
Q3B2H1 1.18e-18 75 47 0 72 3 rpmB Large ribosomal subunit protein bL28 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q83GW8 1.36e-18 75 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Tropheryma whipplei (strain Twist)
Q83IB6 1.36e-18 75 51 0 77 3 rpmB Large ribosomal subunit protein bL28 Tropheryma whipplei (strain TW08/27)
Q058B8 2.34e-18 74 43 0 67 3 rpmB Large ribosomal subunit protein bL28 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q2S6K2 3.61e-18 73 48 0 75 3 rpmB Large ribosomal subunit protein bL28 Salinibacter ruber (strain DSM 13855 / M31)
Q8A999 3.19e-17 72 41 0 75 3 rpmB Large ribosomal subunit protein bL28 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1GIW2 3.28e-17 72 51 1 70 3 rpmB Large ribosomal subunit protein bL28 Ruegeria sp. (strain TM1040)
A1B4S6 3.33e-17 72 51 1 70 3 rpmB Large ribosomal subunit protein bL28 Paracoccus denitrificans (strain Pd 1222)
Q64TK1 3.64e-17 71 41 0 75 3 rpmB Large ribosomal subunit protein bL28 Bacteroides fragilis (strain YCH46)
Q5LCF5 3.64e-17 71 41 0 75 3 rpmB Large ribosomal subunit protein bL28 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q5LUS9 1.03e-16 70 50 1 70 3 rpmB Large ribosomal subunit protein bL28 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A8Z5S7 1.05e-16 70 47 1 71 3 rpmB Large ribosomal subunit protein bL28 Karelsulcia muelleri (strain GWSS)
A6L5E4 1.51e-16 70 40 0 75 3 rpmB Large ribosomal subunit protein bL28 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q6MDF9 4.02e-16 69 38 1 89 3 rpmB Large ribosomal subunit protein bL28 Protochlamydia amoebophila (strain UWE25)
Q254G4 5.41e-16 68 38 1 88 3 rpmB Large ribosomal subunit protein bL28 Chlamydia felis (strain Fe/C-56)
B3QZ92 5.59e-16 68 41 0 74 3 rpmB Large ribosomal subunit protein bL28 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6Q1S4 1.58e-15 67 49 1 65 3 rpmB Large ribosomal subunit protein bL28 Nitratiruptor sp. (strain SB155-2)
A6L9U9 2.07e-15 67 46 2 69 3 rpmB Large ribosomal subunit protein bL28 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
P9WHA9 5e-15 66 46 0 77 3 rpmB2 Large ribosomal subunit protein bL28B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHA8 5e-15 66 46 0 77 3 rpmB2 Large ribosomal subunit protein bL28B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66149 5e-15 66 46 0 77 3 rpmB2 Large ribosomal subunit protein bL28B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q28LS1 1.27e-14 65 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Jannaschia sp. (strain CCS1)
Q823F7 1.3e-14 65 36 1 88 3 rpmB Large ribosomal subunit protein bL28 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A8LHY2 1.7e-14 65 50 1 70 3 rpmB Large ribosomal subunit protein bL28 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q7MTJ4 1.8e-14 64 46 2 69 3 rpmB Large ribosomal subunit protein bL28 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RM15 1.8e-14 64 46 2 69 3 rpmB Large ribosomal subunit protein bL28 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A4WX84 3.25e-14 64 41 2 79 3 rpmB Large ribosomal subunit protein bL28 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B9KCR2 3.87e-14 63 51 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q051S9 4.38e-14 64 44 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RU2 4.38e-14 64 44 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q8F483 5.39e-14 63 44 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RI5 5.39e-14 63 44 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B6IW31 7.57e-14 63 45 1 72 3 rpmB Large ribosomal subunit protein bL28 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q3J4W8 7.93e-14 63 42 1 70 3 rpmB Large ribosomal subunit protein bL28 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PHM3 7.93e-14 63 42 1 70 3 rpmB Large ribosomal subunit protein bL28 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9PKV0 8.39e-14 63 35 2 88 3 rpmB Large ribosomal subunit protein bL28 Chlamydia muridarum (strain MoPn / Nigg)
A7H4T2 9.39e-14 62 48 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HW17 1.05e-13 62 50 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter jejuni (strain RM1221)
A1VYG6 1.05e-13 62 50 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PI58 1.05e-13 62 50 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKN5 1.05e-13 62 50 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A5G211 1.46e-13 63 43 1 71 3 rpmB Large ribosomal subunit protein bL28 Acidiphilium cryptum (strain JF-5)
B5ZRX6 1.93e-13 62 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B3PPE3 1.97e-13 62 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizobium etli (strain CIAT 652)
Q2K3M2 2.06e-13 62 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9Z8L1 2.42e-13 62 40 1 81 3 rpmB Large ribosomal subunit protein bL28 Chlamydia pneumoniae
Q11DS9 2.45e-13 62 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Chelativorans sp. (strain BNC1)
O84088 2.61e-13 62 34 2 90 3 rpmB Large ribosomal subunit protein bL28 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BB73 2.61e-13 62 34 2 90 3 rpmB Large ribosomal subunit protein bL28 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9J4 2.61e-13 62 34 2 90 3 rpmB Large ribosomal subunit protein bL28 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q3KMT5 3.14e-13 62 34 2 90 3 rpmB Large ribosomal subunit protein bL28 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q98FZ7 6.11e-13 61 45 1 70 3 rpmB Large ribosomal subunit protein bL28 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9FDL9 1.21e-12 60 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B6YQB7 1.22e-12 60 38 2 76 3 rpmB Large ribosomal subunit protein bL28 Azobacteroides pseudotrichonymphae genomovar. CFP2
B4RFQ5 1.48e-12 60 44 2 77 3 rpmB Large ribosomal subunit protein bL28 Phenylobacterium zucineum (strain HLK1)
B3CV48 1.86e-12 60 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Orientia tsutsugamushi (strain Ikeda)
Q8U9V8 2.06e-12 60 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Agrobacterium fabrum (strain C58 / ATCC 33970)
B9JBS8 2.08e-12 60 49 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q0AMB1 2.1e-12 60 45 1 77 3 rpmB Large ribosomal subunit protein bL28 Maricaulis maris (strain MCS10)
A9HS05 2.72e-12 59 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A8EVR0 3.61e-12 58 49 1 61 3 rpmB Large ribosomal subunit protein bL28 Aliarcobacter butzleri (strain RM4018)
Q5L637 4.03e-12 58 36 1 82 3 rpmB Large ribosomal subunit protein bL28 Chlamydia abortus (strain DSM 27085 / S26/3)
A6WXD5 4.07e-12 59 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q0BWH4 4.95e-12 58 39 1 76 3 rpmB Large ribosomal subunit protein bL28 Hyphomonas neptunium (strain ATCC 15444)
Q6FYG6 7.78e-12 58 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Bartonella quintana (strain Toulouse)
Q6G5T1 8.4e-12 58 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A5CC87 9.65e-12 58 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Orientia tsutsugamushi (strain Boryong)
A7IHE7 1.25e-11 58 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q46L31 1.27e-11 57 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain NATL2A)
A2C226 1.27e-11 57 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain NATL1A)
P66141 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella suis biovar 1 (strain 1330)
B0CJB7 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella suis (strain ATCC 23445 / NCTC 10510)
P66140 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFQ6 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9A0 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AP2 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella abortus biovar 1 (strain 9-941)
Q2YR56 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella abortus (strain 2308)
B2S8R7 1.31e-11 58 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella abortus (strain S19)
Q5FUP5 1.38e-11 58 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Gluconobacter oxydans (strain 621H)
A1UR12 1.43e-11 57 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92MF4 1.59e-11 57 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizobium meliloti (strain 1021)
Q1GPG7 1.63e-11 57 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A6UCK6 1.66e-11 57 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Sinorhizobium medicae (strain WSM419)
A7GZ69 1.79e-11 56 48 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter curvus (strain 525.92)
A5V8R9 2.14e-11 57 47 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2N6R1 4.84e-11 56 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Erythrobacter litoralis (strain HTCC2594)
A7ZDA4 6.42e-11 55 46 2 64 3 rpmB Large ribosomal subunit protein bL28 Campylobacter concisus (strain 13826)
B9JTL3 6.47e-11 56 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A0RPK6 6.63e-11 55 46 1 62 3 rpmB Large ribosomal subunit protein bL28 Campylobacter fetus subsp. fetus (strain 82-40)
A7HTU2 7.06e-11 56 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5GTS7 7.06e-11 55 42 0 71 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain RCC307)
Q7U6Q8 7.87e-11 55 43 0 64 3 rpmB Large ribosomal subunit protein bL28 Parasynechococcus marenigrum (strain WH8102)
Q98PM6 8.53e-11 55 50 1 64 3 rpmB Large ribosomal subunit protein bL28 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q2GBV3 9.44e-11 55 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P82245 9.98e-11 57 43 0 65 1 RPL28 Large ribosomal subunit protein bL28c Spinacia oleracea
Q0IAB7 1.26e-10 55 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain CC9311)
C3MHW1 1.66e-10 55 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A5VSY2 1.8e-10 55 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q5N223 2.06e-10 54 40 0 71 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31S95 2.06e-10 54 40 0 71 3 rpmB Large ribosomal subunit protein bL28 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A5GL48 2.5e-10 54 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain WH7803)
Q89XZ3 2.53e-10 54 46 0 63 3 rpmB Large ribosomal subunit protein bL28 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B8HUV7 3.21e-10 53 42 0 66 3 rpmB Large ribosomal subunit protein bL28 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B7K8R0 3.74e-10 53 40 0 67 3 rpmB Large ribosomal subunit protein bL28 Gloeothece citriformis (strain PCC 7424)
Q3AJS3 4.36e-10 53 39 0 71 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain CC9605)
Q7VC09 4.6e-10 53 39 0 66 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7MAD1 5.7e-10 52 48 1 62 3 rpmB Large ribosomal subunit protein bL28 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
C6BYE0 5.9e-10 53 57 0 42 3 rpmB Large ribosomal subunit protein bL28 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q7V7P3 6.67e-10 53 42 0 64 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9313)
A2C9W0 6.67e-10 53 42 0 64 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9303)
Q601E3 7.03e-10 52 47 1 63 3 rpmB Large ribosomal subunit protein bL28 Mesomycoplasma hyopneumoniae (strain 232)
P30956 7.65e-10 54 40 0 65 1 RPL28 Large ribosomal subunit protein bL28c Nicotiana tabacum
Q1QQV5 7.7e-10 53 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q7VGN1 7.91e-10 52 49 1 61 3 rpmB Large ribosomal subunit protein bL28 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q2RXY0 8.41e-10 53 42 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3AXY2 8.57e-10 52 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Synechococcus sp. (strain CC9902)
Q3SVL8 9.99e-10 53 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B0UCJ9 1.1e-09 53 42 0 63 3 rpmB Large ribosomal subunit protein bL28 Methylobacterium sp. (strain 4-46)
B8H0R5 1.38e-09 52 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AAE1 1.38e-09 52 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B0SMJ9 1.61e-09 52 34 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SEH0 1.61e-09 52 34 0 70 3 rpmB Large ribosomal subunit protein bL28 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q4A8P2 1.61e-09 52 47 1 63 3 rpmB Large ribosomal subunit protein bL28 Mesomycoplasma hyopneumoniae (strain 7448)
Q7NAV5 1.68e-09 51 44 1 61 3 rpmB Large ribosomal subunit protein bL28 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B1XIH9 1.7e-09 52 40 0 67 3 rpmB Large ribosomal subunit protein bL28 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q6KHM9 1.71e-09 51 45 1 64 3 rpmB Large ribosomal subunit protein bL28 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B8ICZ4 1.72e-09 52 42 0 63 3 rpmB Large ribosomal subunit protein bL28 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q6F1N9 1.95e-09 51 43 1 64 3 rpmB Large ribosomal subunit protein bL28 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q4AAL1 2.07e-09 51 47 1 63 3 rpmB Large ribosomal subunit protein bL28 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
O22795 2.22e-09 53 40 0 65 2 RPL28 Large ribosomal subunit protein bL28c Arabidopsis thaliana
Q30Q52 2.43e-09 51 42 1 61 3 rpmB Large ribosomal subunit protein bL28 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q4A6Y4 2.69e-09 51 48 1 64 3 rpmB Large ribosomal subunit protein bL28 Mycoplasmopsis synoviae (strain 53)
A8IMG3 2.8e-09 52 37 2 79 3 rpmB Large ribosomal subunit protein bL28 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q4L5S5 3.03e-09 51 47 1 57 3 rpmB Large ribosomal subunit protein bL28 Staphylococcus haemolyticus (strain JCSC1435)
Q8DG62 3.17e-09 51 39 0 66 3 rpmB Large ribosomal subunit protein bL28 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A6QC89 3.34e-09 51 49 2 61 3 rpmB Large ribosomal subunit protein bL28 Sulfurovum sp. (strain NBC37-1)
Q6AML3 3.5e-09 50 52 0 42 3 rpmB Large ribosomal subunit protein bL28 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A5ETA3 3.75e-09 52 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8FB10 3.77e-09 50 54 0 42 3 rpmB Large ribosomal subunit protein bL28 Desulfatibacillum aliphaticivorans
A4YKZ2 3.88e-09 51 44 0 63 3 rpmB Large ribosomal subunit protein bL28 Bradyrhizobium sp. (strain ORS 278)
C0MFR4 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus equi subsp. zooepidemicus (strain H70)
B5XIF6 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE31 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48RF4 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RCL6 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J4X4 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JF19 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JK27 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9X9 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66159 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XA13 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE30 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66157 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pyogenes serotype M1
B4U4X8 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8K2 5.52e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus equi subsp. equi (strain 4047)
B1YIP3 5.52e-09 50 49 1 57 3 rpmB Large ribosomal subunit protein bL28 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A2BWN0 5.64e-09 50 35 0 67 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9515)
B9DTK1 5.64e-09 50 48 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B0JLJ8 6.15e-09 50 40 0 64 3 rpmB Large ribosomal subunit protein bL28 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C4L5Y4 6.57e-09 50 49 1 57 3 rpmB Large ribosomal subunit protein bL28 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q5HAZ6 7.34e-09 51 39 0 63 3 rpmB Large ribosomal subunit protein bL28 Ehrlichia ruminantium (strain Welgevonden)
A9BAC7 7.48e-09 50 36 0 66 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9211)
A9VT96 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus mycoides (strain KBAB4)
Q6HEV7 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636G8 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain ZK / E33L)
Q819U9 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVE7 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain Q1)
B7HLJ1 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain AH187)
B7HDY1 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain B4264)
C1EP82 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain 03BB102)
B7IUL7 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain G9842)
Q732L2 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJU5 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus cereus (strain AH820)
A0RHN1 7.58e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus thuringiensis (strain Al Hakam)
Q82ZE4 7.74e-09 50 46 0 47 1 rpmB Large ribosomal subunit protein bL28 Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FFP1 7.83e-09 50 39 0 63 3 rpmB Large ribosomal subunit protein bL28 Ehrlichia ruminantium (strain Gardel)
Q8E268 7.92e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7M7 7.92e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3Q0 7.92e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q81WI0 8.27e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus anthracis
C3L769 8.27e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P629 8.27e-09 50 43 1 57 3 rpmB Large ribosomal subunit protein bL28 Bacillus anthracis (strain A0248)
B3PLS0 8.67e-09 50 47 1 59 3 rpmB Large ribosomal subunit protein bL28 Metamycoplasma arthritidis (strain 158L3-1)
Q68XW7 9.32e-09 50 41 0 63 3 rpmB Large ribosomal subunit protein bL28 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A5IXN6 9.49e-09 50 44 1 69 3 rpmB Large ribosomal subunit protein bL28 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q7V1H0 1.03e-08 50 35 0 67 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A8G4S4 1.17e-08 50 36 0 65 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9215)
B0SXP0 1.18e-08 50 41 0 63 3 rpmB Large ribosomal subunit protein bL28 Caulobacter sp. (strain K31)
A3PCV5 1.32e-08 49 36 0 65 3 rpmB Large ribosomal subunit protein bL28 Prochlorococcus marinus (strain MIT 9301)
C1CPV0 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIU2 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain P1031)
C1CCK4 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain JJA)
A4VT69 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus suis (strain 05ZYH33)
A3CQ97 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus sanguinis (strain SK36)
A4VZF0 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus suis (strain 98HAH33)
P66156 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2ILY3 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain CGSP14)
P66155 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZLK5 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I9N1 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain Hungary19A-6)
C1C5H5 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae (strain 70585)
B5E1Q0 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae serotype 19F (strain G54)
Q04M37 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8AYZ9 1.32e-08 49 46 0 47 3 rpmB Large ribosomal subunit protein bL28 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q13EG6 1.71e-08 50 41 1 70 3 rpmB Large ribosomal subunit protein bL28 Rhodopseudomonas palustris (strain BisB5)
Q9ZE48 1.75e-08 50 41 0 63 3 rpmB Large ribosomal subunit protein bL28 Rickettsia prowazekii (strain Madrid E)
Q3MGW8 1.75e-08 49 38 0 67 3 rpmB Large ribosomal subunit protein bL28 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B3QAG7 1.78e-08 50 42 0 63 3 rpmB Large ribosomal subunit protein bL28 Rhodopseudomonas palustris (strain TIE-1)
Q6NCH9 1.78e-08 50 42 0 63 1 rpmB Large ribosomal subunit protein bL28 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15610
Feature type CDS
Gene rpmB
Product 50S ribosomal protein L28
Location 3470258 - 3470494 (strand: 1)
Length 237 (nucleotides) / 78 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2159
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00830 Ribosomal L28 family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0227 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L28

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02902 large subunit ribosomal protein L28 Ribosome -

Protein Sequence

MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKGIESVLADLRARGEKY

Flanking regions ( +/- flanking 50bp)

GTCAAACCTGATACTAAAGCTCGAGCTGATTAGATTTTTGGAGAATAGACATGTCCCGAGTCTGCCAAGTTACCGGCAAGCGTCCTGTGAGTGGAAACAACCGCTCTCACGCATTAAACGCGACTAAACGCCGTTTTCTGCCAAACCTGCACTCTCACCGTTTCTGGGTTGAGTCTGAGAAACGTTTCGTAACTCTGCGTGTATCTGCTAAAGGTATGCGTGTGATCGATAAGAAAGGCATCGAATCTGTATTAGCAGATTTACGTGCCCGTGGTGAGAAGTACTAAGGAGCTGAAAAATGGCTAAAGGTATTCGCGAGAAAATTAAACTCGTTTCT