Homologs in group_358

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15520 FBDBKF_15520 25.4 Morganella morganii S1 pAS PAS domain
EHELCC_15880 EHELCC_15880 25.4 Morganella morganii S2 pAS PAS domain
NLDBIP_16490 NLDBIP_16490 25.4 Morganella morganii S4 pAS PAS domain
LHKJJB_16315 LHKJJB_16315 25.4 Morganella morganii S3 pAS PAS domain
HKOGLL_16085 HKOGLL_16085 25.4 Morganella morganii S5 pAS PAS domain
F4V73_RS17625 F4V73_RS17625 26.5 Morganella psychrotolerans - PAS domain-containing methyl-accepting chemotaxis protein
PMI_RS13895 PMI_RS13895 25.0 Proteus mirabilis HI4320 - PAS domain-containing methyl-accepting chemotaxis protein

Distribution of the homologs in the orthogroup group_358

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_358

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34311 2.67e-23 103 29 9 291 3 ykoW Signaling protein YkoW Bacillus subtilis (strain 168)
Q9I310 3.84e-23 102 35 3 178 1 mucR Bifunctional diguanylate cyclase/cyclic di-GMP phosphodiesterase MucR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2Z7X0 5.05e-21 95 38 4 163 1 tpbB Diguanylate cyclase TpbB Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I4L5 1e-20 95 38 4 163 1 tpbB Diguanylate cyclase TpbB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ABX9 1.3e-20 95 27 9 294 1 CC_0091 Uncharacterized signaling protein CC_0091 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P54595 1.67e-19 90 38 4 168 4 yhcK Uncharacterized protein YhcK Bacillus subtilis (strain 168)
Q8X8Q3 6.65e-19 89 31 3 176 3 dgcM Diguanylate cyclase DgcM Escherichia coli O157:H7
P77302 6.98e-19 89 31 3 176 1 dgcM Diguanylate cyclase DgcM Escherichia coli (strain K12)
P55552 5.77e-18 87 28 10 283 4 NGR_a02630 Uncharacterized protein y4lL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1RAI4 1.17e-17 86 32 4 193 3 dgcQ Probable diguanylate cyclase DgcQ Escherichia coli (strain UTI89 / UPEC)
Q32HJ0 1.36e-17 86 33 6 195 3 dgcQ Probable diguanylate cyclase DgcQ Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z0N3 1.36e-17 86 33 6 195 3 dgcQ Probable diguanylate cyclase DgcQ Shigella sonnei (strain Ss046)
Q8XB92 1.42e-17 86 33 6 195 3 dgcQ Probable diguanylate cyclase DgcQ Escherichia coli O157:H7
P76330 1.45e-17 86 33 6 195 2 dgcQ Probable diguanylate cyclase DgcQ Escherichia coli (strain K12)
Q5PLI4 2.68e-17 85 33 4 171 3 dgcQ Probable diguanylate cyclase DgcQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57N14 2.78e-17 85 33 4 171 3 dgcQ Probable diguanylate cyclase DgcQ Salmonella choleraesuis (strain SC-B67)
Q8ZNT5 2.8e-17 85 33 4 171 3 dgcQ Probable diguanylate cyclase DgcQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83KM9 3.41e-17 85 32 6 195 5 dgcQ Putative diguanylate cyclase DgcQ Shigella flexneri
Q8FGJ7 7.19e-17 84 32 6 195 3 dgcQ Probable diguanylate cyclase DgcQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H3AFM6 8.57e-17 82 24 8 298 1 VC0395_0300 Diguanylate cyclase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8Z5R0 1.65e-16 83 33 4 171 3 dgcQ Probable diguanylate cyclase DgcQ Salmonella typhi
P64826 5.66e-16 81 32 4 162 4 BQ2027_MB1389C Uncharacterized protein Mb1389c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WM13 5.66e-16 81 32 4 162 4 Rv1354c Uncharacterized protein Rv1354c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WM12 5.66e-16 81 32 4 162 4 MT1397 Uncharacterized protein MT1397 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9KU26 5.71e-15 78 32 6 175 3 mbaA Biofilm architecture maintenance protein MbaA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9HYT3 1.53e-14 77 32 4 167 1 nbdA Cyclic di-GMP phosphodiesterase NbdA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZJS2 1.82e-14 77 33 5 168 1 dgcP Diguanylate cyclase DgcP Pseudomonas aeruginosa (strain UCBPP-PA14)
B8GZM2 2.19e-14 76 34 4 172 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 2.19e-14 76 34 4 172 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9HT84 2.44e-14 76 33 5 168 1 dgcP Diguanylate cyclase DgcP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P77334 2.87e-14 76 31 6 182 1 pdeR Cyclic di-GMP phosphodiesterase PdeR Escherichia coli (strain K12)
Q49VU5 3.12e-14 75 31 6 208 4 SSP1970 Uncharacterized membrane protein SSP1970 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P38097 4.71e-14 76 31 6 190 2 dgcE Probable diguanylate cyclase DgcE Escherichia coli (strain K12)
Q73RG3 5.63e-14 75 33 1 130 1 dgcA Diguanylate cyclase A Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9KKZ4 8.03e-14 74 34 7 168 1 vdcA Diguanylate cyclase VdcA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P76245 1.15e-13 73 33 3 167 1 dgcP Diguanylate cyclase DgcP Escherichia coli (strain K12)
P31129 5.31e-13 71 31 5 176 1 dgcZ Diguanylate cyclase DgcZ Escherichia coli (strain K12)
P0AAP1 9.57e-13 71 35 3 128 1 dgcC Probable diguanylate cyclase DgcC Escherichia coli (strain K12)
P0AAP2 9.57e-13 71 35 3 128 3 dgcC Probable diguanylate cyclase DgcC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q320T0 1.57e-12 70 32 4 164 3 dosC Diguanylate cyclase DosC Shigella boydii serotype 4 (strain Sb227)
P0AA89 1.57e-12 70 32 4 164 1 dosC Diguanylate cyclase DosC Escherichia coli (strain K12)
P0AA90 1.57e-12 70 32 4 164 3 dosC Diguanylate cyclase DosC Escherichia coli O157:H7
P46139 2.31e-12 70 33 5 167 1 dgcN Diguanylate cyclase DgcN Escherichia coli (strain K12)
Q8EJM6 3e-12 70 24 6 286 1 pdeB Cyclic di-GMP phosphodiesterase PdeB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O34325 3.78e-12 70 32 6 182 4 ytrP Uncharacterized protein YtrP Bacillus subtilis (strain 168)
Q3Z1N3 8.73e-12 68 32 4 164 3 dosC Diguanylate cyclase DosC Shigella sonnei (strain Ss046)
Q8XAZ4 9.16e-12 68 29 4 179 3 dgcF Probable diguanylate cyclase DgcF Escherichia coli O157:H7
Q8X6V3 7.68e-11 65 32 7 173 3 dgcI Probable diguanylate cyclase DgcI Escherichia coli O157:H7
P75801 7.9e-11 65 32 7 173 3 dgcI Probable diguanylate cyclase DgcI Escherichia coli (strain K12)
P76147 8.72e-11 65 27 4 209 3 dgcF Probable diguanylate cyclase DgcF Escherichia coli (strain K12)
Q8CTF5 9.52e-11 65 29 6 211 4 SE_0528 Uncharacterized membrane protein SE_0528 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQY3 9.52e-11 65 29 6 211 4 SERP0413 Uncharacterized membrane protein SERP0413 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q55434 1.94e-10 65 30 5 169 1 cph2 Phytochrome-like protein cph2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55434 1.11e-09 62 33 3 133 1 cph2 Phytochrome-like protein cph2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7DLB7 2.5e-10 63 32 5 192 4 None Uncharacterized membrane protein in llm 5'region Staphylococcus aureus
Q5HHS4 2.5e-10 63 32 5 192 4 SACOL0809 Uncharacterized membrane protein SACOL0809 Staphylococcus aureus (strain COL)
Q6GIP5 2.5e-10 63 32 5 192 4 SAR0800 Uncharacterized membrane protein SAR0800 Staphylococcus aureus (strain MRSA252)
Q2G061 2.5e-10 63 32 5 192 4 SAOUHSC_00760 Uncharacterized membrane protein SAOUHSC_00760 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q7A2V2 2.5e-10 63 32 5 192 4 SAV0746 Uncharacterized membrane protein SAV0746 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FIP5 2.5e-10 63 32 5 192 4 SAUSA300_0730 Uncharacterized membrane protein SAUSA300_0730 Staphylococcus aureus (strain USA300)
Q6GB84 2.5e-10 63 32 5 192 4 SAS0711 Uncharacterized membrane protein SAS0711 Staphylococcus aureus (strain MSSA476)
Q7A1G8 2.5e-10 63 32 5 192 4 MW0708 Uncharacterized membrane protein MW0708 Staphylococcus aureus (strain MW2)
Q99VM8 2.5e-10 63 32 5 192 4 SA0701 Uncharacterized membrane protein SA0701 Staphylococcus aureus (strain N315)
Q2YSF9 2.5e-10 63 32 5 192 4 SAB0698c Uncharacterized membrane protein SAB0698c Staphylococcus aureus (strain bovine RF122 / ET3-1)
P76237 2.53e-10 64 30 4 162 1 dgcJ Probable diguanylate cyclase DgcJ Escherichia coli (strain K12)
Q4L4H1 2.87e-10 63 29 6 174 4 SH2145 Uncharacterized membrane protein SH2145 Staphylococcus haemolyticus (strain JCSC1435)
P76236 3.55e-10 63 28 4 183 1 cdgI Probable diguanylate cyclase CdgI Escherichia coli (strain K12)
Q8EGF8 4.45e-10 62 29 4 166 1 dgcS Diguanylate cyclase DgcS Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P75908 7.58e-10 62 27 4 172 1 dgcT Probable diguanylate cyclase DgcT Escherichia coli (strain K12)
P74101 3.32e-09 61 27 6 197 4 sll1895 Uncharacterized protein sll1895 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P36892 4.29e-09 58 38 3 88 4 None Uncharacterized 19.3 kDa protein in repSA 5'region Streptomyces ambofaciens
P24222 1.17e-06 52 29 5 127 4 None Uncharacterized protein in hutH 5'region (Fragment) Streptomyces griseus
P76129 1.75e-05 49 25 5 187 1 dosP Oxygen sensor protein DosP Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15350
Feature type CDS
Gene -
Product sensor domain-containing diguanylate cyclase
Location 3408987 - 3409892 (strand: 1)
Length 906 (nucleotides) / 301 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_358
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00990 Diguanylate cyclase, GGDEF domain
PF13426 PAS domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2199 Signal transduction mechanisms (T) T GGDEF domain, diguanylate cyclase (c-di-GMP synthetase) or its enzymatically inactive variants

Protein Sequence

MSELVINNNIVNDLLIKQFTNYVFMMIVTDIKGNIIYANKKYCQFNHINFESIKNKRYNLFYLVDENQDVFSNISDNKEVIRLEAKNPNKNKQEVWEDINIVPIFDKNNLISHYAFLSLDITDKVKLRNDLLNKSYIDSLTGMANRLSIIEKIEQERLNIATPSSFCLGIIDCDKFKTINDQYGHAIGDHVLCEIAQRLLALERQQVYCGRLGGDEFAVLFPAGLRSCSLLLLEIIESLWRGMEKPIKINKEKTIVPSISLGIAEYPKDGKTLSELLKSADKQLYAIKEKGGNKYGFYSEY

Flanking regions ( +/- flanking 50bp)

TCAGATAAATAATAAAAACTATGCTTTATTGATAAGCATAGGAGGAAAAAATGAGTGAATTAGTAATTAATAATAATATTGTTAATGACTTATTAATAAAGCAATTTACTAATTATGTATTTATGATGATAGTAACAGATATAAAAGGTAATATTATCTACGCTAATAAAAAATACTGCCAATTTAATCATATTAATTTTGAAAGTATAAAAAATAAAAGATATAACTTGTTTTATTTAGTTGATGAAAATCAAGATGTGTTTTCTAACATTAGTGATAATAAAGAGGTAATAAGATTAGAGGCAAAAAACCCAAATAAAAATAAACAAGAAGTATGGGAAGATATTAATATCGTTCCAATTTTTGATAAAAATAATCTAATTTCTCATTATGCATTTTTAAGTTTAGATATCACGGATAAAGTAAAGTTAAGAAATGATTTATTAAATAAAAGCTATATTGACTCTTTAACTGGAATGGCTAACCGTCTAAGTATTATTGAGAAAATTGAACAGGAGCGATTAAATATTGCGACACCTTCATCTTTTTGTCTTGGGATTATTGATTGTGATAAATTCAAAACGATTAATGATCAATATGGCCATGCTATTGGTGATCATGTTTTATGTGAGATAGCGCAGCGTTTATTAGCCTTAGAACGCCAGCAGGTTTACTGTGGACGACTTGGTGGCGATGAATTTGCGGTACTTTTCCCTGCTGGATTACGTTCTTGCTCTTTATTGTTATTGGAGATCATCGAATCGCTATGGCGAGGAATGGAAAAACCGATAAAAATCAATAAAGAAAAAACAATTGTTCCTTCTATTAGCTTAGGTATTGCTGAATACCCTAAGGATGGCAAGACATTATCTGAACTATTAAAGTCAGCAGATAAACAGCTTTATGCAATAAAAGAGAAAGGAGGAAATAAATACGGTTTTTATTCAGAGTATTAAATAACACTATATTTCAAATAAAAGTCATTATTAATAAATAAAAATCTCCT