Homologs in group_2101

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15445 FBDBKF_15445 64.4 Morganella morganii S1 mioC FMN-binding protein MioC
EHELCC_15805 EHELCC_15805 64.4 Morganella morganii S2 mioC FMN-binding protein MioC
NLDBIP_16565 NLDBIP_16565 64.4 Morganella morganii S4 mioC FMN-binding protein MioC
LHKJJB_16240 LHKJJB_16240 64.4 Morganella morganii S3 mioC FMN-binding protein MioC
HKOGLL_16010 HKOGLL_16010 64.4 Morganella morganii S5 mioC FMN-binding protein MioC
F4V73_RS17700 F4V73_RS17700 65.8 Morganella psychrotolerans mioC FMN-binding protein MioC

Distribution of the homologs in the orthogroup group_2101

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2101

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03817 4.47e-61 187 63 0 146 1 mioC Protein MioC Escherichia coli (strain K12)
P58208 8.7e-60 184 62 0 146 3 mioC Protein MioC Escherichia coli O157:H7
P44813 1.9e-48 155 52 0 139 3 mioC Protein MioC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KVY6 1.16e-43 143 47 0 136 3 mioC Protein MioC homolog Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9L6A2 2.55e-40 135 42 0 140 3 mioC Protein MioC homolog Pasteurella multocida (strain Pm70)
Q47418 1.92e-20 84 33 1 148 3 None Flavodoxin YqcA Pectobacterium carotovorum subsp. carotovorum
P65369 5.91e-20 83 33 2 148 3 yqcA Uncharacterized protein YqcA Shigella flexneri
P65367 5.91e-20 83 33 2 148 1 yqcA Flavodoxin YqcA Escherichia coli (strain K12)
P65368 5.91e-20 83 33 2 148 3 yqcA Uncharacterized protein YqcA Escherichia coli O157:H7
Q9HYH1 7.27e-20 83 37 2 147 1 PA3435 Uncharacterized protein PA3435 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54B10 2.46e-15 75 33 2 125 2 redA NADPH oxidoreductase A Dictyostelium discoideum
O32214 1.01e-14 73 32 4 141 1 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Bacillus subtilis (strain 168)
Q87L90 1.88e-12 66 32 4 141 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7N8L6 2.19e-12 66 29 3 138 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8C1A3 3.13e-12 66 32 3 125 1 Mtrr Methionine synthase reductase Mus musculus
A8ANX1 1.63e-11 63 32 5 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P18086 2.37e-11 60 32 5 147 3 Desal_0805 Flavodoxin Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q5PEH7 2.68e-11 63 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MJ63 2.96e-11 63 32 3 128 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Cronobacter sakazakii (strain ATCC BAA-894)
Q4JIJ2 3.53e-11 63 32 3 125 2 MTRR Methionine synthase reductase Bos taurus
P38039 3.73e-11 63 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6TD49 3.84e-11 63 32 4 140 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q32CG3 4.03e-11 62 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella dysenteriae serotype 1 (strain Sd197)
A1JJS2 5.59e-11 62 28 3 138 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P52674 5.78e-11 62 32 2 120 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Thiocapsa roseopersicina
A8A3P5 8.88e-11 62 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O9:H4 (strain HS)
Q3YY94 9.77e-11 62 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella sonnei (strain Ss046)
Q31XM4 1.04e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella boydii serotype 4 (strain Sb227)
P38038 1.04e-10 61 31 4 143 1 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain K12)
B1IU77 1.04e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZQK7 1.04e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O139:H28 (strain E24377A / ETEC)
P00323 1.07e-10 59 33 3 129 1 DVU_2680 Flavodoxin Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57KH7 1.09e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella choleraesuis (strain SC-B67)
Q8X7U1 1.11e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O157:H7
Q1R7T4 1.14e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli (strain UTI89 / UPEC)
Q0TEA2 1.14e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEV0 1.14e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O1:K1 / APEC
Q8FEI7 1.15e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q498R1 1.18e-10 61 31 3 125 2 Mtrr Methionine synthase reductase Rattus norvegicus
Q8Z458 1.2e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella typhi
Q9UBK8 1.3e-10 61 32 3 125 1 MTRR Methionine synthase reductase Homo sapiens
A9N2E6 1.34e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q83QD9 1.44e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella flexneri
Q0T1I8 1.44e-10 61 31 4 143 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shigella flexneri serotype 5b (strain 8401)
Q66ED4 1.69e-10 61 33 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPY5 1.72e-10 61 33 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pestis (strain Pestoides F)
Q1CLS8 1.72e-10 61 33 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZBN6 1.89e-10 60 33 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pestis
Q1C3Z0 1.89e-10 60 33 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pestis bv. Antiqua (strain Antiqua)
A9MF16 2.18e-10 60 31 4 140 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q6D1A1 2.75e-10 60 31 3 130 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5F3I4 2.94e-10 60 31 3 139 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MHA5 3.15e-10 60 30 2 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio vulnificus (strain YJ016)
Q9KUX4 3.18e-10 60 31 3 139 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DCK2 3.28e-10 60 30 2 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Vibrio vulnificus (strain CMCP6)
Q2NVN4 5.13e-10 59 31 3 138 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Sodalis glossinidius (strain morsitans)
A7FLZ0 7.64e-10 59 32 3 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q01095 7.66e-10 57 32 4 132 1 None Flavodoxin Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q6LM58 9.79e-10 58 31 5 141 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Photobacterium profundum (strain SS9)
Q90703 9.94e-10 58 30 3 130 2 NOS2 Nitric oxide synthase, inducible Gallus gallus
P57503 1.07e-09 58 29 2 129 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q17574 1.13e-09 58 30 2 124 3 mtrr-1 Methionine synthase reductase Caenorhabditis elegans
A4WDW1 1.51e-09 58 31 4 140 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Enterobacter sp. (strain 638)
Q8K9D3 1.55e-09 58 30 2 128 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q54JL0 2.26e-09 57 32 4 143 2 redC NADPH-dependent diflavin oxidoreductase 1 Dictyostelium discoideum
Q8EAZ9 2.45e-09 57 30 3 129 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6CCH0 2.54e-09 57 30 3 146 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Yarrowia lipolytica (strain CLIB 122 / E 150)
P50126 2.69e-09 57 30 3 149 2 NCP1 NADPH--cytochrome P450 reductase Candida maltosa
Q6BR77 4.44e-09 57 31 3 149 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q7VQH2 6.73e-09 56 28 2 125 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Blochmanniella floridana
Q01096 7.17e-09 54 33 4 129 3 None Flavodoxin Megalodesulfovibrio gigas
A8G9X6 7.31e-09 56 29 4 131 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Serratia proteamaculans (strain 568)
Q65T53 7.38e-09 56 31 3 128 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5E841 9.23e-09 56 31 4 141 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5NRM1 1.47e-08 55 28 3 146 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q4WU59 2.18e-08 55 29 3 158 3 tah18 NADPH-dependent diflavin oxidoreductase 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P14779 2.46e-08 55 33 7 142 1 cyp102A1 Bifunctional cytochrome P450/NADPH--P450 reductase Priestia megaterium (strain ATCC 14581 / DSM 32 / CCUG 1817 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / NRRL B-14308 / VKM B-512 / Ford 19)
P16603 3.69e-08 54 31 4 130 1 NCP1 NADPH--cytochrome P450 reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P37040 4.42e-08 54 30 3 126 1 Por NADPH--cytochrome P450 reductase Mus musculus
P00388 4.5e-08 54 30 3 126 1 Por NADPH--cytochrome P450 reductase Rattus norvegicus
Q9JS45 4.87e-08 53 31 4 130 3 cysJ1 Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9LZ73 5.9e-08 53 31 4 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup C (strain 053442)
P80312 6.3e-08 52 30 4 139 1 Ddes_1951 Flavodoxin Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q9JUD8 6.38e-08 53 31 4 126 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P16435 7.35e-08 53 30 3 126 1 POR NADPH--cytochrome P450 reductase Homo sapiens
Q81BF4 8.58e-08 53 31 7 147 1 CYP102A5 Bifunctional cytochrome P450/NADPH--P450 reductase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P00389 9.26e-08 53 27 5 152 1 POR NADPH--cytochrome P450 reductase Oryctolagus cuniculus
Q1LTP1 1.28e-07 52 29 3 125 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Baumannia cicadellinicola subsp. Homalodisca coagulata
P04175 1.28e-07 52 26 2 126 1 POR NADPH--cytochrome P450 reductase Sus scrofa
P37039 1.41e-07 52 28 3 126 2 Por NADPH--cytochrome P450 reductase Cavia porcellus
Q3SYT8 1.71e-07 52 26 2 126 2 POR NADPH--cytochrome P450 reductase Bos taurus
P26492 2.37e-07 50 29 5 140 1 None Flavodoxin Desulfovibrio desulfuricans
A1KU06 3.14e-07 51 32 4 124 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q0CMM0 3.85e-07 51 28 4 149 3 cprA NADPH--cytochrome P450 reductase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q0HYB4 3.99e-07 51 31 3 129 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain MR-7)
P37201 4.35e-07 51 29 2 129 3 NCP1 NADPH--cytochrome P450 reductase Candida tropicalis
A0A2U1LIM9 4.72e-07 51 28 5 159 1 CPR1 NADPH--cytochrome P450 reductase 1 Artemisia annua
Q5BFT5 8.87e-07 50 25 3 140 3 cprA NADPH--cytochrome P450 reductase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q0HFL6 1.12e-06 50 30 3 129 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain MR-4)
Q5AD27 1.13e-06 50 27 3 130 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
A0KTH4 1.14e-06 50 30 3 129 3 cysJ Sulfite reductase [NADPH] flavoprotein alpha-component Shewanella sp. (strain ANA-3)
O34589 1.38e-06 48 27 2 116 3 ykuP Probable flavodoxin 2 Bacillus subtilis (strain 168)
Q92091 1.67e-06 49 27 3 130 2 nos2 Nitric oxide synthase, inducible (Fragment) Oncorhynchus mykiss
P0CP12 1.76e-06 49 25 3 120 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP13 1.76e-06 49 25 3 120 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
O94613 1.88e-06 49 27 3 143 3 tah18 NADPH-dependent diflavin oxidoreductase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q06518 1.9e-06 49 29 3 138 1 Nos2 Nitric oxide synthase, inducible Rattus norvegicus
Q1K9C2 2.12e-06 49 28 3 126 3 sir1 Sulfite reductase [NADPH] subunit beta Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q94IN5 2.68e-06 49 27 2 118 1 PNO Pyruvate dehydrogenase [NADP(+)], mitochondrial Euglena gracilis
A2QS05 2.97e-06 48 28 5 149 2 cprA NADPH--cytochrome P450 reductase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q9HDG2 3.59e-06 48 25 3 136 2 CPR NADPH--cytochrome P450 reductase Phanerodontia chrysosporium
Q4WM67 4.19e-06 48 28 4 134 1 cprA NADPH--cytochrome P450 reductase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4HZQ1 4.52e-06 48 29 2 133 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q4P3D8 5.04e-06 48 27 2 106 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Ustilago maydis (strain 521 / FGSC 9021)
Q28314 7.62e-06 47 34 0 84 2 NOS2 Nitric oxide synthase, inducible Capra hircus
Q2UHA7 7.74e-06 47 27 4 140 3 cprA NADPH--cytochrome P450 reductase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q00141 8.76e-06 47 27 5 148 1 cprA NADPH--cytochrome P450 reductase Aspergillus niger
Q968X7 1.49e-05 47 27 3 153 2 PFOR Pyruvate dehydrogenase [NADP(+)] Cryptosporidium parvum
A0A2U1KZS6 1.5e-05 47 28 6 160 3 CPR2 NADPH--cytochrome P450 reductase 2 Artemisia annua
P29477 1.96e-05 46 28 3 138 1 Nos2 Nitric oxide synthase, inducible Mus musculus
Q6FRH1 2.08e-05 46 29 6 144 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O62699 2.42e-05 46 29 2 125 2 NOS2 Nitric oxide synthase, inducible Canis lupus familiaris
Q12181 2.83e-05 46 29 4 142 1 TAH18 NADPH-dependent diflavin oxidoreductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q07994 2.91e-05 46 25 3 128 2 None NADPH--cytochrome P450 reductase Musca domestica
P35228 3.76e-05 45 33 1 98 1 NOS2 Nitric oxide synthase, inducible Homo sapiens
Q27995 3.95e-05 45 33 0 84 2 NOS2 Nitric oxide synthase, inducible Bos taurus
Q0J705 3.95e-05 45 27 3 130 1 CPR2 NADPH--cytochrome P450 reductase 2 Oryza sativa subsp. japonica
Q1JPJ0 4.94e-05 45 26 7 157 2 NDOR1 NADPH-dependent diflavin oxidoreductase 1 Bos taurus
Q9SUM3 5.11e-05 45 29 4 131 1 ATR2 NADPH--cytochrome P450 reductase 2 Arabidopsis thaliana
P79290 6.31e-05 45 34 1 90 2 NOS2 Nitric oxide synthase, inducible Sus scrofa
P37116 6.85e-05 45 28 3 129 1 None NADPH--cytochrome P450 reductase Vigna radiata var. radiata
Q6PFP6 7.24e-05 45 25 7 157 2 ndor1 NADPH-dependent diflavin oxidoreductase 1 Danio rerio
Q5BB41 8.72e-05 44 29 3 120 3 tah18 NADPH-dependent diflavin oxidoreductase 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P71165 8.79e-05 43 28 5 144 1 DvMF_1143 Flavodoxin Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8VQF4 0.000109 43 40 0 60 1 cinC Cindoxin Citrobacter braakii
O54705 0.00015 43 27 3 132 2 NOS2 Nitric oxide synthase, inducible Cavia porcellus
Q653S9 0.000191 43 28 3 130 1 CPR3 NADPH--cytochrome P450 reductase 3 Oryza sativa subsp. japonica
Q27597 0.000682 42 25 3 128 1 Cpr NADPH--cytochrome P450 reductase Drosophila melanogaster
Q8RXN5 0.000789 42 26 3 118 2 TYW1 S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase Arabidopsis thaliana
Q6CVG8 0.000847 42 28 4 141 3 TAH18 NADPH-dependent diflavin oxidoreductase 1 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15125
Feature type CDS
Gene mioC
Product FMN-binding protein MioC
Location 3357461 - 3357901 (strand: 1)
Length 441 (nucleotides) / 146 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2101
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00258 Flavodoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0369 Nucleotide transport and metabolism (F)
Inorganic ion transport and metabolism (P)		 FP Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06205 MioC protein - -

Protein Sequence

MKKVTLISGSTMGSAEYVAEHLEEILSKEGFETDLHHGPSLNDLPQEGIWLVITSTHGAGEIPDNLQPFADEISADGIDLSKVSFGAVGIGSSEYDTFCGAIRTLDQKLIEKGAVRLGDRLEIDIQEHDIPEDPAEEWLTTWKNLL

Flanking regions ( +/- flanking 50bp)

AAGTGATTCACAGCGTACAATAGCGCGTCTTGAACATAAGGAGATCATGAATGAAAAAAGTCACGCTAATTAGTGGCAGCACCATGGGTAGTGCTGAATATGTCGCCGAACACCTCGAAGAGATCTTATCTAAAGAGGGATTTGAGACAGATCTACACCATGGGCCTTCTCTTAATGATCTTCCGCAAGAAGGGATCTGGTTGGTGATCACTTCCACACACGGTGCAGGTGAGATCCCAGATAACCTCCAGCCATTTGCTGACGAAATCTCAGCAGACGGCATTGATCTAAGTAAAGTTTCTTTCGGTGCTGTAGGTATAGGAAGTAGTGAATATGACACTTTCTGTGGTGCGATCAGAACATTAGATCAAAAACTAATAGAAAAAGGGGCTGTTCGATTAGGTGATCGCCTAGAAATAGATATACAAGAACACGACATTCCGGAAGATCCAGCAGAGGAATGGCTTACAACTTGGAAAAATTTACTTTAAATCGAACAAAAAAACAGCAATCAGATGTGGATAACTATGCTTAAAAGCAG