Homologs in group_2944

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14960 FBDBKF_14960 87.5 Morganella morganii S1 nanE Putative N-acetylmannosamine-6-phosphate epimerase
EHELCC_11285 EHELCC_11285 87.5 Morganella morganii S2 nanE Putative N-acetylmannosamine-6-phosphate epimerase
NLDBIP_11630 NLDBIP_11630 87.5 Morganella morganii S4 nanE Putative N-acetylmannosamine-6-phosphate epimerase
LHKJJB_11490 LHKJJB_11490 87.5 Morganella morganii S3 nanE Putative N-acetylmannosamine-6-phosphate epimerase
HKOGLL_10100 HKOGLL_10100 87.5 Morganella morganii S5 nanE Putative N-acetylmannosamine-6-phosphate epimerase

Distribution of the homologs in the orthogroup group_2944

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2944

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZY9 1.04e-172 477 100 0 232 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Proteus mirabilis (strain HI4320)
Q9L6B4 1.69e-108 314 69 0 214 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Pasteurella multocida (strain Pm70)
B8F667 1.64e-103 301 65 0 213 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Glaesserella parasuis serovar 5 (strain SH0165)
B3GZ03 1.89e-101 296 66 0 212 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N350 1.89e-101 296 66 0 212 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BSI0 2.97e-101 296 66 0 212 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P59442 1.61e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella flexneri
Q0T067 1.61e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella flexneri serotype 5b (strain 8401)
B1IQQ6 1.61e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A533 1.61e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O9:H4 (strain HS)
Q3YX25 2.52e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella sonnei (strain Ss046)
Q32BB6 3.07e-99 291 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella dysenteriae serotype 1 (strain Sd197)
Q31W92 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella boydii serotype 4 (strain Sb227)
B2U1W1 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LGI8 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain SMS-3-5 / SECEC)
B6I1U1 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain SE11)
B7NDK1 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A761 8.31e-99 290 64 0 225 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain K12)
P0A762 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCP3 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGB7 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O1:K1 / APEC
B1XHJ6 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain K12 / DH10B)
C4ZSW1 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0T5 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O8 (strain IAI1)
B7MBY5 8.31e-99 290 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NKT4 1.27e-98 289 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSV0 1.33e-98 289 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9G9 1.33e-98 289 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O157:H7
B5F7J7 1.62e-98 289 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Salmonella agona (strain SL483)
P71340 2.15e-98 288 63 0 214 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B7LRJ1 2.32e-98 288 63 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7UJV6 3.26e-98 288 63 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q939I2 4.04e-98 288 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Klebsiella aerogenes
A6TEN5 4.81e-98 288 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5PLF1 5.28e-98 288 64 0 225 3 nanE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7ZSB6 7.33e-98 287 63 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZLQ7 7.33e-98 287 64 0 225 1 nanE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N831 2.31e-97 286 64 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A9MNY8 3.04e-97 286 63 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P60668 8.06e-96 282 64 0 225 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Salmonella typhi
P60631 8.06e-96 282 64 0 225 3 nanE1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PG85 2.13e-95 281 64 0 225 3 nanE1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7VKN0 1.87e-94 279 66 0 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C5B754 4.28e-93 275 61 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Edwardsiella ictaluri (strain 93-146)
B5XSS5 2.18e-92 273 61 0 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Klebsiella pneumoniae (strain 342)
Q5E735 4.41e-91 270 57 2 229 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LPV5 1.17e-86 259 59 1 216 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Photobacterium profundum (strain SS9)
C3LNA0 1.71e-78 238 51 1 226 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Vibrio cholerae serotype O1 (strain M66-2)
Q9KR62 1.71e-78 238 51 1 226 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7B9 2.35e-78 238 51 1 226 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B1JFV9 5.56e-76 232 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TMJ5 1.18e-75 231 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pestis (strain Pestoides F)
Q1CJY8 1.18e-75 231 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCG8 1.18e-75 231 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pestis
Q1C5U6 1.18e-75 231 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FG95 2.32e-75 230 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q668J7 3.18e-75 230 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K948 3.18e-75 230 60 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q7MD32 4.05e-73 224 52 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Vibrio vulnificus (strain YJ016)
Q8D613 4.05e-73 224 52 1 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Vibrio vulnificus (strain CMCP6)
Q8YBP2 1.3e-61 204 49 2 228 3 nanEK Bifunctional enzyme NanE/NanK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWN5 3.56e-61 202 50 2 225 3 nanEK Bifunctional enzyme NanE/NanK Brucella suis biovar 1 (strain 1330)
Q0SWI9 1.2e-44 152 37 3 216 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Clostridium perfringens (strain SM101 / Type A)
Q8XNZ3 6.69e-44 150 37 3 216 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Clostridium perfringens (strain 13 / Type A)
Q0TUP9 6.69e-44 150 37 3 216 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q185B2 8.21e-43 147 35 3 216 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Clostridioides difficile (strain 630)
Q8R7I7 1.06e-41 144 36 6 233 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1JIP7 5.05e-41 143 38 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M2 (strain MGAS10270)
P65523 5.11e-41 143 38 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P65522 5.11e-41 143 38 4 221 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M1
B5XJP1 7.36e-41 142 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M49 (strain NZ131)
B9DVU8 1.4e-40 142 36 4 229 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A2RCG2 1.56e-40 141 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8K5 1.74e-40 141 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M4 (strain MGAS10750)
P0DC69 3.54e-40 140 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VD6 3.54e-40 140 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JNJ8 3.54e-40 140 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDM7 3.54e-40 140 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DC68 3.54e-40 140 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8KU93 9.38e-40 139 35 4 222 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5XDY5 9.74e-40 139 37 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A0AMC4 2.25e-39 139 38 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y3N4 2.66e-39 138 37 3 224 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q97Q95 3.03e-39 138 33 6 230 3 nanE1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DGQ5 3.54e-39 138 42 4 229 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q6A6A0 4.65e-39 137 41 7 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8DD13 7.62e-39 137 36 3 224 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria monocytogenes serotype 4a (strain HCC23)
C1L0D5 3.09e-38 135 36 3 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q71VW2 3.19e-38 135 36 3 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria monocytogenes serotype 4b (strain F2365)
Q926V7 7.45e-38 134 36 4 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q660M6 1.2e-37 134 34 6 234 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q74HT0 1.75e-37 134 35 5 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
C1CSU8 2.1e-37 133 34 6 232 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pneumoniae (strain Taiwan19F-14)
C1C8S3 2.1e-37 133 34 6 232 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus pneumoniae (strain 70585)
P65521 2.1e-37 133 34 6 232 3 nanE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65520 2.1e-37 133 34 6 232 3 nanE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q040Z7 5.23e-37 132 35 5 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8DPF0 6.83e-37 132 33 5 233 3 nanE1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q0SMK9 7.44e-37 132 33 6 234 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Borreliella afzelii (strain PKo)
B7J2K0 3.76e-36 130 33 5 224 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Borreliella burgdorferi (strain ZS7)
O51589 3.76e-36 130 33 5 224 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A4VW79 2.52e-35 128 34 4 231 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus suis (strain 05ZYH33)
C5VXY0 2.52e-35 128 34 4 231 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus suis (strain P1/7)
P0CB52 5.1e-35 127 34 4 232 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus suis
A8AUI0 8.9e-35 127 33 5 233 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q6MT55 9.92e-35 126 32 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A2RKU2 1.59e-34 126 34 7 226 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactococcus lactis subsp. cremoris (strain MG1363)
Q3K3Z4 1.85e-34 125 34 4 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9CGC2 2.19e-34 125 36 5 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactococcus lactis subsp. lactis (strain IL1403)
Q02YU5 2.32e-34 125 33 4 224 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactococcus lactis subsp. cremoris (strain SK11)
Q4L9T7 2.59e-34 125 34 4 222 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus haemolyticus (strain JCSC1435)
P65519 2.97e-34 125 34 4 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65518 2.97e-34 125 34 4 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus agalactiae serotype III (strain NEM316)
Q98QJ8 1.44e-33 123 34 6 225 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8RDN5 1.48e-33 123 33 2 216 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5WK54 4.17e-33 122 34 5 223 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Shouchella clausii (strain KSM-K16)
B9DIJ5 6.53e-33 121 34 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus carnosus (strain TM300)
P65517 1.59e-32 120 35 4 217 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain N315)
P65516 1.59e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPI5 1.59e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain JH9)
A6TYA2 1.59e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain JH1)
A7WXZ6 1.59e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NYC4 1.89e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain MW2)
Q6GCF3 1.89e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain MSSA476)
A8YZE2 2.71e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GJZ8 2.71e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain MRSA252)
A6QDV0 2.71e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain Newman)
Q5HJ50 2.71e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain COL)
Q2G157 2.71e-32 120 35 4 217 1 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJU6 2.71e-32 120 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain USA300)
Q2YVA8 3.58e-32 119 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8EMP6 4.34e-32 119 35 4 217 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2SS69 6.54e-32 119 32 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A3CK30 1.54e-31 118 33 5 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Streptococcus sanguinis (strain SK36)
Q38V36 7.99e-31 116 33 3 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Latilactobacillus sakei subsp. sakei (strain 23K)
Q4A094 3.3e-30 114 34 4 218 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4WDW4 5.85e-30 114 37 3 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Enterobacter sp. (strain 638)
P59441 6.09e-28 108 37 3 220 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8EWM9 9.44e-28 108 31 4 219 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Malacoplasma penetrans (strain HF-2)
Q03HR3 5.47e-27 106 37 5 222 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8NMD0 5.86e-25 101 33 5 222 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QH48 5.86e-25 101 33 5 222 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Corynebacterium glutamicum (strain R)
Q5N1J0 2.22e-19 86 38 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KC5 2.22e-19 86 38 4 221 3 nanE Putative N-acetylmannosamine-6-phosphate 2-epimerase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14725
Feature type CDS
Gene -
Product N-acetylmannosamine-6-phosphate 2-epimerase
Location 3264700 - 3265398 (strand: -1)
Length 699 (nucleotides) / 232 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2944
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF04131 Putative N-acetylmannosamine-6-phosphate epimerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3010 Carbohydrate transport and metabolism (G) G Putative N-acetylmannosamine-6-phosphate epimerase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01788 N-acylglucosamine-6-phosphate 2-epimerase [EC:5.1.3.9] Amino sugar and nucleotide sugar metabolism
Metabolic pathways		 -

Protein Sequence

MALIEKMTKDIQQKGGLIVSCQPVDNSPMDKPDIVAAMAQAAVNAGAVAVRIEGIDNLKATRPLIDVPIIGIVKRDLPDSPVRITPWLNDIEALAAAGADIIAFDGTDRLRPVPVKALLEHVHRLGKLAMADCATFNEGMYCHQLGTEFIGSTMSGYTGGEIPKLPDLQLVTALAEQGCRVIAEGRYNTPMMAARGMQAGAWAVTVGSALTRLEHVCEWFTQALKWQQELDK

Flanking regions ( +/- flanking 50bp)

ATAATATAATTCGGAGTTACATTTCAAAAAAAGAGAGCAGTGAGTTCAACATGGCACTAATTGAAAAGATGACTAAAGATATTCAACAAAAAGGTGGGTTAATTGTTTCTTGCCAACCTGTTGATAATAGTCCAATGGATAAACCTGACATTGTAGCCGCAATGGCTCAAGCAGCAGTAAATGCAGGTGCCGTCGCAGTACGTATTGAAGGAATTGATAATTTAAAAGCAACACGTCCTCTTATTGATGTGCCAATTATTGGAATTGTAAAACGTGATTTGCCTGATAGCCCTGTCAGGATCACGCCTTGGTTAAATGATATTGAAGCATTGGCTGCAGCTGGTGCAGATATTATCGCTTTTGATGGTACTGATCGCCTACGCCCAGTTCCCGTGAAAGCATTGCTAGAGCATGTTCATCGTTTAGGAAAACTAGCGATGGCAGATTGTGCCACTTTTAATGAAGGGATGTATTGTCATCAACTCGGTACCGAATTTATTGGCTCAACGATGTCAGGTTATACCGGTGGGGAAATACCAAAATTACCCGATCTTCAACTGGTGACCGCATTAGCAGAGCAAGGATGTCGAGTGATTGCGGAAGGGCGTTATAACACACCAATGATGGCGGCAAGGGGTATGCAAGCGGGAGCTTGGGCTGTCACCGTTGGCTCTGCATTAACTCGTCTTGAACATGTCTGTGAGTGGTTTACTCAGGCATTAAAGTGGCAGCAGGAGTTAGATAAATGAATACATTAGCGATTGATATTGGAGGAACCAAAATCTCGGCAGCATTAATT