Homologs in group_146

Help

9 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01250 FBDBKF_01250 23.8 Morganella morganii S1 proP MFS family permease, includes anhydromuropeptide permease AmpG
EHELCC_00295 EHELCC_00295 23.8 Morganella morganii S2 proP MFS family permease, includes anhydromuropeptide permease AmpG
NLDBIP_03165 NLDBIP_03165 23.8 Morganella morganii S4 proP MFS family permease, includes anhydromuropeptide permease AmpG
LHKJJB_04680 LHKJJB_04680 23.8 Morganella morganii S3 proP MFS family permease, includes anhydromuropeptide permease AmpG
HKOGLL_02365 HKOGLL_02365 23.8 Morganella morganii S5 proP MFS family permease, includes anhydromuropeptide permease AmpG
F4V73_RS07290 F4V73_RS07290 25.0 Morganella psychrotolerans - MFS transporter
F4V73_RS17430 F4V73_RS17430 23.1 Morganella psychrotolerans - MFS transporter
PMI_RS06055 PMI_RS06055 26.5 Proteus mirabilis HI4320 - MFS transporter
PMI_RS15265 PMI_RS15265 16.4 Proteus mirabilis HI4320 - MFS transporter

Distribution of the homologs in the orthogroup group_146

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_146

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37594 4.55e-89 284 35 4 496 3 smvA Methyl viologen resistance protein SmvA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D0ZXQ3 4.55e-89 284 35 4 496 1 smvA Methyl viologen resistance protein SmvA Salmonella typhimurium (strain 14028s / SGSC 2262)
P0A0J9 1.62e-76 252 33 10 487 1 qacA Antiseptic resistance protein Staphylococcus aureus
P0A0J8 1.62e-76 252 33 10 487 3 qacA Antiseptic resistance protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
P34698 6.27e-65 221 35 3 414 3 SACE_5813 Uncharacterized MFS-type transporter SACE_5813 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A0R5K5 4.01e-58 203 34 4 461 2 lfrA Multidrug efflux pump LfrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WG90 1.46e-40 156 27 3 441 3 stp Multidrug resistance protein Stp Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WG91 2.35e-40 155 27 5 443 1 stp Multidrug resistance protein Stp Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P39886 6.83e-40 154 28 7 416 3 tcmA Tetracenomycin C resistance and export protein Streptomyces glaucescens
P9WJW9 5.91e-39 151 28 6 429 2 jefA Drug efflux pump JefA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJW8 5.91e-39 151 28 6 429 3 jefA Drug efflux pump JefA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P54585 1.9e-37 147 26 8 429 3 yhcA Uncharacterized MFS-type transporter YhcA Bacillus subtilis (strain 168)
P9WG87 4.83e-35 141 28 14 451 3 Rv1250 Uncharacterized MFS-type transporter Rv1250 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG86 4.83e-35 141 28 14 451 3 MT1289 Uncharacterized MFS-type transporter MT1289 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O34502 2.32e-34 137 31 13 430 3 yvkA Uncharacterized MFS-type transporter YvkA Bacillus subtilis (strain 168)
P94422 5.11e-34 137 26 2 349 3 ycnB Uncharacterized MFS-type transporter YcnB Bacillus subtilis (strain 168)
Q180E3 1.12e-33 135 29 7 411 1 ribZ Riboflavin transporter RibZ Clostridioides difficile (strain 630)
P0AEJ0 1.62e-32 133 27 7 412 1 emrB Multidrug export protein EmrB Escherichia coli (strain K12)
P0AEJ1 1.62e-32 133 27 7 412 3 emrB Multidrug export protein EmrB Escherichia coli O157:H7
P11545 1.89e-32 132 26 4 413 3 mmr Methylenomycin A resistance protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P31474 5.69e-32 131 29 11 397 1 hsrA Probable transport protein HsrA Escherichia coli (strain K12)
C6DBD0 7.58e-31 127 27 7 421 3 mdtD Putative multidrug resistance protein MdtD Pectobacterium carotovorum subsp. carotovorum (strain PC1)
O35018 1.28e-30 127 29 3 340 3 lmrB Lincomycin resistance protein LmrB Bacillus subtilis (strain 168)
Q6D2A9 1.58e-30 127 28 7 420 3 mdtD Putative multidrug resistance protein MdtD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q00538 2.31e-30 126 29 6 409 3 mmr Methylenomycin A resistance protein Bacillus subtilis (strain 168)
P96712 2.42e-30 127 27 5 403 1 bmr3 Multidrug resistance protein 3 Bacillus subtilis (strain 168)
P46105 8.1e-30 126 28 9 421 3 actII-2 Probable actinorhodin transporter Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A8AEE4 9.02e-30 125 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P44903 2.85e-29 123 28 11 419 3 hsrA Probable transport protein HsrA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RQ29 5.72e-29 123 26 9 420 1 farB Fatty acid resistance protein FarB Neisseria gonorrhoeae
P52600 8.59e-29 122 25 3 404 2 emrY Probable multidrug resistance protein EmrY Escherichia coli (strain K12)
A4WCC3 3.6e-28 120 26 11 448 3 mdtD Putative multidrug resistance protein MdtD Enterobacter sp. (strain 638)
O32182 7.71e-28 120 26 10 427 3 yusP Uncharacterized MFS-type transporter YusP Bacillus subtilis (strain 168)
B5XPB7 5.7e-27 117 26 12 464 3 mdtD Putative multidrug resistance protein MdtD Klebsiella pneumoniae (strain 342)
A6TBH6 9.6e-27 116 26 7 441 3 mdtD Putative multidrug resistance protein MdtD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8GHR1 1.31e-26 115 26 10 452 3 mdtD Putative multidrug resistance protein MdtD Serratia proteamaculans (strain 568)
B7LV41 1.36e-26 115 28 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A1JKW8 1.44e-26 115 26 11 445 3 mdtD Putative multidrug resistance protein MdtD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P42670 2.37e-26 115 28 5 416 3 pur8 Puromycin resistance protein pur8 Streptomyces alboniger
B1JSD2 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TMR4 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pestis (strain Pestoides F)
Q1CK62 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZU7 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pestis bv. Antiqua (strain Angola)
Q7CJL1 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pestis
B2K9M2 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5L8 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pestis bv. Antiqua (strain Antiqua)
A7FG15 3.68e-26 114 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8Y9K8 5.69e-26 114 25 4 398 3 lmrB Lincomycin resistance protein LmrB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P9WG88 6.55e-26 114 25 12 471 3 emrB Multidrug resistance protein B homolog Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q668C4 8.79e-26 113 27 6 441 3 mdtD Putative multidrug resistance protein MdtD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q92EE1 1.08e-25 113 25 4 398 3 lmrB Lincomycin resistance protein LmrB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P44927 2.37e-25 112 27 4 339 3 emrB Multidrug export protein EmrB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P76269 1.5e-24 109 26 7 407 3 yebQ Uncharacterized transporter YebQ Escherichia coli (strain K12)
G4MWA9 2.25e-24 110 26 12 457 2 MFS1 MFS-type efflux transporter MFS1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P46104 3.31e-24 108 26 5 409 3 lmrA Lincomycin resistance protein Streptomyces lincolnensis
P9WG89 6.26e-24 108 28 5 323 3 emrB Multidrug resistance protein B homolog Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B4SXW2 2e-23 106 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella newport (strain SL254)
B5R0C2 2e-23 106 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella enteritidis PT4 (strain P125109)
B5EXV9 2e-23 106 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella agona (strain SL483)
B5FMU8 2.32e-23 106 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella dublin (strain CT_02021853)
B5BF67 2.98e-23 105 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella paratyphi A (strain AKU_12601)
Q5PDW9 2.98e-23 105 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TNI8 3.1e-23 105 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella schwarzengrund (strain CVM19633)
P94574 3.25e-23 105 25 8 425 3 ywoD Uncharacterized MFS-type transporter YwoD Bacillus subtilis (strain 168)
B4T9U3 3.27e-23 105 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella heidelberg (strain SL476)
Q8Z5F5 3.83e-23 105 26 9 450 3 mdtD Putative multidrug resistance protein MdtD Salmonella typhi
Q8ZNQ0 8.68e-23 104 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B6HYS2 9.42e-23 104 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain SE11)
A9N7L0 1.23e-22 103 25 9 452 3 mdtD Putative multidrug resistance protein MdtD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B7L9V0 1.28e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain 55989 / EAEC)
B2TYA6 1.48e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P36554 1.48e-22 103 27 10 453 1 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain K12)
B1IYZ7 1.48e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1U9 1.48e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O9:H4 (strain HS)
B1X7H3 1.48e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain K12 / DH10B)
C4ZSG5 1.48e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain K12 / MC4100 / BW2952)
B5YUD5 1.72e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7I3 1.72e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O157:H7
B7NCB3 2.29e-22 103 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3Z0C7 2.83e-22 102 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Shigella sonnei (strain Ss046)
Q83QZ0 3.41e-22 102 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Shigella flexneri
B7M460 4.03e-22 102 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O8 (strain IAI1)
B7NQA9 4.22e-22 102 27 9 448 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UTB5 4.89e-22 102 27 11 456 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LNW4 5.12e-22 102 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain SMS-3-5 / SECEC)
Q323D8 5.31e-22 102 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Shigella boydii serotype 4 (strain Sb227)
A1ACT2 6.51e-22 102 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O1:K1 / APEC
Q1R9Z4 7.01e-22 101 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli (strain UTI89 / UPEC)
B7ME89 7.01e-22 101 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0T353 1.07e-21 101 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Shigella flexneri serotype 5b (strain 8401)
Q8FG02 1.67e-21 100 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZNQ0 1.67e-21 100 27 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TG13 5.56e-21 99 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q04733 7.88e-21 99 27 8 413 3 cmcT Cephamycin export protein CmcT Amycolatopsis lactamdurans
B7MWZ0 9.73e-21 98 26 10 453 3 mdtD Putative multidrug resistance protein MdtD Escherichia coli O81 (strain ED1a)
A0A6J4B6H5 2.01e-20 97 24 13 460 3 LUC4 MFS-type efflux pump LUC4 Fusarium sp.
A7MHI9 4.57e-20 96 25 10 452 3 mdtD Putative multidrug resistance protein MdtD Cronobacter sakazakii (strain ATCC BAA-894)
S0EEY7 4.76e-20 96 25 11 417 2 FUS6 Efflux pump FUS6 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WJY5 5.81e-20 96 25 11 439 1 efpA Uncharacterized MFS-type transporter EfpA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJY4 5.81e-20 96 25 11 439 3 efpA Uncharacterized MFS-type transporter EfpA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
W7MLD3 2.25e-19 94 23 12 500 3 FUS6 Efflux pump FUS6 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A0D1DYJ6 1.61e-18 92 26 10 428 1 MMF1 MFS-type efflux pump MMF1 Ustilago maydis (strain 521 / FGSC 9021)
A0A4P8DK16 4.08e-18 90 25 11 399 3 dmxR4 MFS-type transporter dmxR4 Cryptosporiopsis sp. (strain 8999)
M9M5N8 4.8e-18 90 26 13 469 1 MMF1 MFS-type efflux pump MMF1 Pseudozyma antarctica (strain T-34)
P23054 1.86e-17 88 24 11 433 3 tetB Tetracycline resistance protein Bacillus subtilis (strain 168)
A0A8F4NW86 2.09e-17 88 26 10 333 3 gkaD MFS-type transporter gkaD Penicillium citrinum
Q4WKA1 2.84e-17 88 23 0 256 2 mfsC Major facilitator superfamily multidrug transporter mfsC Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A1L9WQV4 3.84e-17 87 23 11 463 2 ASPACDRAFT_1881869 Acurin A biosynthesis cluster MFS-type transporter Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A0E3D8L1 1.83e-16 85 25 11 340 3 PC-17 MFS-type transporter PC-17 Penicillium crustosum
P0A4K6 7.51e-16 83 22 8 426 3 tet Tetracycline resistance protein Streptococcus pneumoniae
P0A4K8 7.51e-16 83 22 8 426 3 tet Tetracycline resistance protein Bacillus subtilis
P0A4K7 7.51e-16 83 22 8 426 3 tet Tetracycline resistance protein Bacillus cereus
M1WG91 1.58e-15 82 26 13 391 3 CPUR_05422 MFS-type transporter CPUR_05422 Claviceps purpurea (strain 20.1)
P07561 1.66e-15 82 22 9 427 3 tet Tetracycline resistance protein Geobacillus stearothermophilus
O31563 2.03e-15 82 25 10 354 3 yfiU Uncharacterized MFS-type transporter YfiU Bacillus subtilis (strain 168)
A0A140JWS3 3.61e-15 81 24 10 324 3 ptmT MFS-type transporter ptmT Penicillium simplicissimum
M2YI75 7.34e-15 80 24 8 342 2 dotC Efflux pump dotC Dothistroma septosporum (strain NZE10 / CBS 128990)
Q9P6J7 8.59e-15 80 22 5 380 3 SPBC1683.03c Uncharacterized MFS-type transporter C1683.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q10072 1.79e-14 79 25 11 416 3 SPAC3H1.06c Uncharacterized transporter C3H1.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
I1RF56 2.08e-14 79 23 14 493 2 aurT Rubrofusarin-specific efflux pump aurT Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P13924 2.15e-14 79 22 10 426 3 tet Tetracycline resistance protein Streptococcus agalactiae
Q2UPC1 2.66e-14 79 23 9 347 3 aclA MFS efflux transporter aclA Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A443HJZ5 3.75e-14 78 25 7 331 3 VdtG MFS-type transporter VdtG Byssochlamys spectabilis
Q04301 4.38e-14 78 21 14 520 1 VBA1 Vacuolar basic amino acid transporter 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A2V5HGL3 5.45e-14 77 27 9 319 3 ungB MFS-type transporter ungB Aspergillus violaceofuscus (strain CBS 115571)
Q6GGX2 6.38e-14 77 27 11 372 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain MRSA252)
A0A4Q4NMP3 8.1e-14 77 24 11 402 2 MFS54 MFS-type transporter MFS54 Alternaria alternata
Q8NWQ5 9.12e-14 77 27 12 384 1 norB Quinolone resistance protein NorB Staphylococcus aureus (strain MW2)
Q6G9C6 1.17e-13 76 28 13 382 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain MSSA476)
Q8TFD3 1.34e-13 76 24 8 333 2 dotC Efflux pump dotC Dothistroma septosporum
Q5HFY7 1.69e-13 76 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain COL)
A0A5B8YU71 1.73e-13 76 23 12 360 2 GME11371 MFS-type transporter GME11371 Pestalotiopsis microspora
A8Z415 1.81e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain USA300 / TCH1516)
A6QGY6 1.81e-13 75 27 12 384 2 norB Quinolone resistance protein NorB Staphylococcus aureus (strain Newman)
Q2FYJ5 1.81e-13 75 27 12 384 1 norB Quinolone resistance protein NorB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH03 1.81e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain USA300)
Q7A5M0 1.84e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain N315)
Q99U52 1.84e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISW7 1.84e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain JH9)
A6U1Q6 1.84e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain JH1)
A7X2C6 1.84e-13 75 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain Mu3 / ATCC 700698)
A0A2I1C3U4 2.06e-13 75 24 13 477 3 nsrN MFS-type transporter nsrN Aspergillus novofumigatus (strain IBT 16806)
P9WG85 3.47e-13 75 25 4 345 3 Rv1877 Uncharacterized MFS-type transporter Rv1877 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG84 3.47e-13 75 25 4 345 3 MT1926 Uncharacterized MFS-type transporter MT1926 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8J0F3 3.85e-13 75 25 13 443 1 mlcE Efflux pump mlcE Penicillium citrinum
A0A3G1DJE2 4.3e-13 75 22 10 479 3 L2 MFS transporter L2 Phoma sp. (strain ATCC 20986 / MF5453)
Q2UEK9 7.41e-13 74 23 6 338 2 astH MFS-type transporter astH Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q08902 7.87e-13 74 23 12 395 1 AMF1 Low affinity ammonium transporter Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A8F4NV97 8.72e-13 74 24 11 354 3 pydD MFS-type transporter pydD Acremonium sp.
M2YMU2 9.87e-13 73 25 12 393 3 MYCFIDRAFT_190113 MFS-type transporter MYCFIDRAFT_190113 Pseudocercospora fijiensis (strain CIRAD86)
A0A2L0P0L8 1.02e-12 73 23 16 470 3 TwmF MFS-type transporter TwmF Talaromyces wortmannii
C8VQ97 1.3e-12 73 24 5 337 3 ausY MFS-type transporter ausY Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q2YY45 1.48e-12 73 27 12 384 3 norB Quinolone resistance protein NorB Staphylococcus aureus (strain bovine RF122 / ET3-1)
P36890 1.62e-12 73 21 8 432 3 tet Tetracycline resistance protein Staphylococcus hyicus
Q9HE13 1.69e-12 73 25 11 416 3 SPAC1399.02 Uncharacterized MFS-type transporter C1399.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O42922 1.84e-12 73 21 14 479 3 SPBC16A3.17c Uncharacterized MFS-type transporter C16A3.17c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
M1WCQ0 2.07e-12 73 26 10 333 2 tcpA MFS thioclapurine efflux transporter tcpA Claviceps purpurea (strain 20.1)
D7PI13 2.09e-12 73 24 12 406 1 gsfJ Probable efflux pump gsfJ Penicillium aethiopicum
A0A0N7D7C9 7.3e-12 71 23 10 450 2 Dhc2 Dehydrocurvularin exporter Alternaria cinerariae
A0A345BJP3 7.67e-12 71 23 16 509 3 clz4 MFS-type transporter clz4 Cochliobolus lunatus
P9WEP4 7.88e-12 71 25 10 335 3 olcL MFS-type transporter olcL Penicillium canescens
A0A0C1C354 9.5e-12 70 27 7 252 3 opaD MFS-type transporter opaD Aspergillus ustus
A0A0F9XXG3 1.31e-11 70 24 10 404 3 thnB MFS-type transporter thnB Trichoderma harzianum
P62967 1.44e-11 70 23 17 480 3 tet Tetracycline resistance protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P02983 1.44e-11 70 23 17 480 3 tet Tetracycline resistance protein Staphylococcus aureus
Q99S97 1.5e-11 70 25 11 404 1 sdrM Multidrug efflux pump SdrM Staphylococcus aureus (strain N315)
A0A142I724 1.67e-11 70 30 3 169 3 phomT MFS-type transporter phomT Diaporthe leptostromiformis
P0DPR7 2.6e-11 69 20 7 412 2 emrB Colistin resistance protein EmrB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
A0A2Z1U8L7 2.66e-11 69 23 6 303 1 pigP MFS-type transporter pigP Monascus ruber
A0A3G1DJG1 3.13e-11 69 22 16 509 2 M2 MFS-type transporter M2 Phoma sp. (strain ATCC 20986 / MF5453)
B6HJU0 3.62e-11 68 22 16 506 1 roqT Efflux pump roqT Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
B5BP47 7.25e-11 68 24 21 514 3 SPBC460.03 Uncharacterized transporter C460.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A6F8RNA5 7.67e-11 68 24 9 345 3 grgE MFS-type transporter grgE Penicillium sp.
L7X3H5 9.24e-11 67 24 13 402 3 curE Dehydrocurvularin exporter Aspergillus terreus
A0A0U5GJZ5 9.35e-11 67 23 5 338 3 ausY MFS-type transporter ausY Aspergillus calidoustus
E9R876 2.11e-10 66 25 9 366 2 gliA MFS gliotoxin efflux transporter gliA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0QWU7 2.18e-10 66 25 16 400 1 mfs Triacylglyceride transporter MSMEG_3069/MSMEI_2992 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0A411KUX1 2.2e-10 66 24 9 348 3 ucsD MFS-type transporter ucsD Acremonium sp.
Q6F5E3 2.22e-10 66 23 20 505 3 TP Aspyridones efflux protein Neocamarosporium betae
K5B8L6 2.27e-10 66 25 13 387 1 C731_2106 Triacylglyceride transporter MHAS_02168/C731_2106 Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849)
Q6UEH3 3.23e-10 65 25 3 226 2 aflT Efflux pump aflT Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
B8NWW7 4.75e-10 65 23 9 407 3 lnaF MFS-type transporter lnaF Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
D2E9W8 8.24e-10 64 24 11 373 2 DEP3 Efflux pump DEP3 Alternaria brassicicola
E1ACQ6 9.8e-10 64 23 7 368 1 notK Efflux pump notK Aspergillus sp. (strain MF297-2)
B3FWS2 1.03e-09 64 29 2 154 3 hpm6 Efflux pump hmp6 Hypomyces subiculosus
A0A1L7TV54 1.19e-09 64 23 15 458 2 FPY5 MFS-type transporter FPY5 Fusarium mangiferae
Q0D1P9 1.26e-09 64 24 8 305 2 terJ Efflux pump terJ Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q6C8F0 1.65e-09 63 21 14 449 3 CEX1 Citrate exporter 1 Yarrowia lipolytica (strain CLIB 122 / E 150)
Q0D1P6 2.21e-09 63 24 13 321 2 terG Efflux pump terG Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B1MCB5 5.63e-09 62 25 12 386 1 mfs Triacylglyceride transporter MAB_2807 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
P38358 6.35e-09 62 25 14 388 1 VBA2 Vacuolar basic amino acid transporter 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P36172 8.31e-09 61 24 15 467 3 VBA5 Vacuolar basic amino acid transporter 5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A4P8W7F5 8.88e-09 61 22 11 426 3 pyiT MFS-type efflux transporter pyiT Pyricularia grisea
A0A1E1FFK8 1.04e-08 61 22 10 394 3 prhG MFS-type transporter prhG Penicillium brasilianum
E5AE35 1.11e-08 61 26 7 238 2 MFS Phomenoic acid biosynthesis cluster MFS-type transporter Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
A0A3G9H2R5 1.2e-08 61 22 9 334 1 cdmB MFS-type transporter cdmB Talaromyces verruculosus
P13090 1.47e-08 60 30 6 189 1 ATR1 Aminotriazole resistance protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
G4N2A8 2.09e-08 60 20 13 541 3 MFS1 MFS-type transporter 1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A1V6PBC8 2.46e-08 60 27 2 155 1 calB MFS-type transporter calB Penicillium decumbens
Q0D153 2.94e-08 59 29 3 168 2 ATEG_00331 MFS-type transporter ATEG_00331 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P32369 3.3e-08 59 25 4 183 3 baiG Bile acid transporter Clostridium scindens (strain JCM 10418 / VPI 12708)
Q6GIU7 4.37e-08 58 28 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain MRSA252)
Q3S2U5 4.39e-08 59 27 2 155 1 mokI Efflux pump mokI Monascus pilosus
Q5HHX4 5.17e-08 58 27 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain COL)
P0A0J6 5.6e-08 58 27 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain MW2)
P0A0J7 5.6e-08 58 27 1 140 1 norA Quinolone resistance protein NorA Staphylococcus aureus
P0A0J5 5.6e-08 58 27 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain N315)
P0A0J4 5.6e-08 58 27 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GBD5 5.85e-08 58 27 1 140 3 norA Quinolone resistance protein NorA Staphylococcus aureus (strain MSSA476)
Q9CCP7 7.45e-08 58 25 19 496 3 ML0556 Probable triacylglyceride transporter ML0556 Mycobacterium leprae (strain TN)
D4AXV8 8.3e-08 58 28 4 160 3 MFS1 MFS-type efflux pump MFS1 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
F2SH39 8.37e-08 58 28 4 160 2 MFS1 MFS-type efflux pump MFS1 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
A0A0F7U0Z9 9.94e-08 58 29 3 156 3 ausY MFS-type transporter ausY Penicillium brasilianum
A0A1W5SP56 1.54e-07 57 21 13 389 2 pgmG MFS-type transporter pgmG Aspergillus terreus
A0A1L9UQW4 2.13e-07 57 25 6 268 3 bfoC Efflux pump bfoC Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
A0A1W5T3J9 2.28e-07 57 24 9 316 2 poxA MFS-type transporter poxA Penicillium oxalicum
S7ZK48 2.28e-07 57 24 9 316 2 poxA MFS-type transporter poxA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
A0A7L8UVD5 2.34e-07 57 23 11 392 3 ffsH MFS-type efflux transporter ffsH Aspergillus flavipes
A2RJJ9 3.29e-07 56 25 8 288 1 uriP Uridine/deoxyuridine transporter Lactococcus lactis subsp. cremoris (strain MG1363)
O59726 4.43e-07 56 28 6 200 3 fnx2 Vacuolar membrane amino acid uptake transporter fnx2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q796Q1 7.27e-07 55 25 2 159 3 yitG Uncharacterized MFS-type transporter YitG Bacillus subtilis (strain 168)
Q09752 7.36e-07 55 22 13 492 2 fnx1 Multidrug resistance protein fnx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8EA87 7.99e-07 55 30 1 148 3 mdtL Multidrug resistance protein MdtL Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0A254TZW7 8.03e-07 55 26 3 143 3 cex1 Citrate exporter 1 Aspergillus niger
G3Y4N5 8.03e-07 55 26 3 143 3 cex1 Citrate exporter 1 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
B7LK52 1.25e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0SYP9 1.26e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella flexneri serotype 5b (strain 8401)
B7NF27 1.26e-06 54 29 3 140 3 mdtL Multidrug resistance protein MdtL Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NR12 1.32e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83PL6 1.37e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella flexneri
B7M562 1.42e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O8 (strain IAI1)
A7ZTR5 1.42e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O139:H28 (strain E24377A / ETEC)
Q328Z8 1.44e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella dysenteriae serotype 1 (strain Sd197)
B1LL36 1.46e-06 54 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain SMS-3-5 / SECEC)
Q3YWK3 1.48e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella sonnei (strain Ss046)
Q31UW4 1.48e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella boydii serotype 4 (strain Sb227)
B2TUR5 1.48e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IX28 1.48e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6H2 1.48e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O9:H4 (strain HS)
B6I3U3 1.5e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain SE11)
P31462 1.5e-06 53 29 3 139 1 mdtL Multidrug resistance protein MdtL Escherichia coli (strain K12)
B1X9T9 1.5e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain K12 / DH10B)
C4ZYY8 1.5e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain K12 / MC4100 / BW2952)
B7L855 1.5e-06 53 29 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain 55989 / EAEC)
S7Z6Y2 1.66e-06 54 25 16 432 3 opdM MFS-type transporter opdM Penicillium oxalicum (strain 114-2 / CGMCC 5302)
Q87FV4 1.81e-06 53 25 3 188 3 mdtL Multidrug resistance protein MdtL Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P9WJY3 2.04e-06 53 24 13 395 1 Rv1410c Triacylglyceride transporter Rv1410c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJY2 2.04e-06 53 24 13 395 3 MT1454 Triacylglyceride transporter MT1454 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C6DTH3 2.04e-06 53 24 13 395 3 TBMG_02570 Triacylglyceride transporter TBMG_02570 Mycobacterium tuberculosis (strain KZN 1435 / MDR)
A5WM93 2.04e-06 53 24 13 395 3 TBFG_11439 Triacylglyceride transporter TBFG_11439 Mycobacterium tuberculosis (strain F11)
A5U2B2 2.04e-06 53 24 13 395 3 MRA_1419 Triacylglyceride transporter MRA_1419 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AN55 2.04e-06 53 24 13 395 3 JTY_1446 Probable triacylglyceride transporter JTY_1446 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIJ9 2.04e-06 53 24 13 395 1 BCG_1471c Probable triacylglyceride transporter BCG_1471c Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U042 2.04e-06 53 24 13 395 3 BQ2027_MB1445C Probable triacylglyceride transporter Mb1445c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B5XZP2 2.18e-06 53 27 3 140 3 mdtL Multidrug resistance protein MdtL Klebsiella pneumoniae (strain 342)
A9MJT5 2.34e-06 53 27 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A0L190 2.51e-06 53 27 1 155 3 mdtL Multidrug resistance protein MdtL Shewanella sp. (strain ANA-3)
O31762 2.89e-06 53 24 6 183 1 ymfD Bacillibactin exporter Bacillus subtilis (strain 168)
A8ACM0 3.59e-06 52 25 3 160 3 mdtL Multidrug resistance protein MdtL Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5YXB4 3.93e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XB24 3.93e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O157:H7
Q8FBV0 4.52e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N2F5 4.52e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O81 (strain ED1a)
A0A1U8QYH7 4.77e-06 52 21 11 384 2 alnE Efflux pump alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A2QBE9 5.22e-06 52 28 3 177 3 aunc Efflux pump aunC Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A6TG19 5.31e-06 52 25 3 158 3 mdtL Multidrug resistance protein MdtL Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1R4M4 5.54e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli (strain UTI89 / UPEC)
A1AHP3 5.54e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O1:K1 / APEC
B7MGD1 5.54e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O45:K1 (strain S88 / ExPEC)
G3XSI4 5.77e-06 52 27 3 173 3 aunc Efflux pump aunC Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A0M9EQT6 6.07e-06 52 21 13 500 2 DEP3 Efflux pump DEP3 Fusarium langsethiae
B7UMH7 6.15e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0TAZ8 6.6e-06 52 28 3 139 3 mdtL Multidrug resistance protein MdtL Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q00357 9.6e-06 52 21 15 506 3 TOXA MFS-type transporter TOXA Cochliobolus carbonum
Q8BRU6 1.25e-05 51 34 1 93 1 Slc18a2 Synaptic vesicular amine transporter Mus musculus
C0Q2L5 1.66e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella paratyphi C (strain RKS4594)
Q57HZ5 1.66e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella choleraesuis (strain SC-B67)
B4TAV4 1.71e-05 50 24 4 195 3 mdtL Multidrug resistance protein MdtL Salmonella heidelberg (strain SL476)
Q8ZKY1 1.72e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MX86 1.77e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SYB3 1.77e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella newport (strain SL254)
B5EYX7 1.83e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella agona (strain SL483)
P33335 1.88e-05 50 29 6 179 1 SGE1 Protein SGE1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P77589 1.93e-05 50 28 5 153 1 mhpT 3-(3-hydroxy-phenyl)propionate transporter Escherichia coli (strain K12)
A1CFL0 1.94e-05 50 27 5 142 1 patC Efflux pump patC Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q797E3 1.99e-05 50 30 1 137 1 pbuE Purine efflux pump PbuE Bacillus subtilis (strain 168)
P39843 2.04e-05 50 28 2 150 3 blt Multidrug resistance protein 2 Bacillus subtilis (strain 168)
A0A1B5L780 2.06e-05 50 24 11 341 3 ustT Efflux pump ustT Ustilaginoidea virens
P94774 2.55e-05 50 27 6 202 2 exuT Galacturonate transporter Dickeya chrysanthemi
B5QUQ6 2.68e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella enteritidis PT4 (strain P125109)
B5FN15 2.68e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella dublin (strain CT_02021853)
B5BIM0 2.92e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella paratyphi A (strain AKU_12601)
Q5PKV6 2.92e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q01827 3.05e-05 50 33 1 93 1 Slc18a2 Synaptic vesicular amine transporter Rattus norvegicus
Q27963 3.09e-05 50 33 1 93 1 SLC18A2 Synaptic vesicular amine transporter Bos taurus
P25594 3.13e-05 50 25 14 375 1 VBA3 Vacuolar basic amino acid transporter 3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8Z2N9 3.16e-05 50 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella typhi
Q0CJC4 3.5e-05 50 21 15 406 2 pgmG MFS-type transporter pgmG Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P37597 3.9e-05 49 29 7 199 1 ydhC Inner membrane transport protein YdhC Escherichia coli (strain K12)
B8MKZ7 4.16e-05 49 24 3 163 1 tstL MFS-type transporter phiL Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q05940 4.36e-05 49 32 1 93 1 SLC18A2 Synaptic vesicular amine transporter Homo sapiens
Q0UI03 4.85e-05 49 22 6 336 2 elcC MFS-type efflux pump elcC Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
B4TN12 5.35e-05 49 26 4 165 3 mdtL Multidrug resistance protein MdtL Salmonella schwarzengrund (strain CVM19633)
P32482 8.85e-05 48 25 0 157 3 cmlA Chloramphenicol resistance protein Pseudomonas aeruginosa
Q32EI1 9.99e-05 48 25 6 259 5 mdtD Putative multidrug resistance protein MdtD Shigella dysenteriae serotype 1 (strain Sd197)
Q6FNQ2 0.000108 48 25 3 163 3 AQR1 Multidrug transporter AQR1 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
A0A3G1DIQ9 0.000133 48 26 3 167 3 R5 MFS-type transporter R5 Phoma sp. (strain ATCC 20986 / MF5453)
Q5BEJ9 0.000147 48 24 13 319 1 afoB Efflux pump afoB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P53943 0.000159 48 24 3 163 1 AQR1 Probable transporter AQR1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A345BJP9 0.000171 47 25 3 167 3 clz19 MFS-type transporter clz19 Cochliobolus lunatus
Q03263 0.000173 47 30 1 95 1 YMR279C Uncharacterized transporter YMR279C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A075TRA9 0.000179 47 31 4 115 1 patC MFS-type transporter patC Penicillium expansum
A0A348HAX9 0.000193 47 26 4 164 1 phiD MFS-type transporter phiD Fungal sp. (strain ATCC 74256)
P14551 0.000265 47 25 3 170 3 tetB Tetracycline resistance determinant Streptomyces rimosus
B8MKZ1 0.000283 47 26 3 150 1 tstD MFS-type transporter tstD Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q43975 0.000467 46 23 4 176 1 pcaK 4-hydroxybenzoate transporter PcaK Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P34711 0.000467 46 25 3 156 1 unc-17 Vesicular acetylcholine transporter unc-17 Caenorhabditis elegans
P77726 0.000498 46 35 6 134 1 yajR Inner membrane transport protein YajR Escherichia coli (strain K12)
Q0V6Q0 0.000794 45 21 10 432 3 phmH MFS-type efflux transporter phmH Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
O34724 0.000797 45 27 1 158 3 yceJ Uncharacterized MFS-type transporter YceJ Bacillus subtilis (strain 168)
O07569 0.000879 45 28 1 126 3 yhjO Uncharacterized MFS-type transporter YhjO Bacillus subtilis (strain 168)
P33449 0.001 45 23 1 139 3 bmr Multidrug resistance protein 1 Bacillus subtilis (strain 168)
P50080 0.001 45 24 2 150 1 AZR1 Azole resistance protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14645
Feature type CDS
Gene -
Product MFS transporter
Location 3244529 - 3246028 (strand: 1)
Length 1500 (nucleotides) / 499 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_146
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF07690 Major Facilitator Superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2814 Carbohydrate transport and metabolism (G) G Predicted arabinose efflux permease AraJ, MFS family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08167 MFS transporter, DHA2 family, multidrug resistance protein - Multidrug resistance, efflux pump QacA

Protein Sequence

MIKDYKRWIVLLLVSSMLFLIVVDVTVLYTALPRLTHDLNASASEKLWIMNAYPLIVAGLLPAAGMLTDRIGHKTLFISGLPLFAIASLCAAYSPSATSLIISRGFLAVGAAMSMPATLSIVRQVFTHPQERAVAIGIWSAVASGGAALGPLIGGLLLNHFWWGSVFLINVPIVLLVLPFSIWLIPHFSGQRQHKIDYLSSILILIGLVSAIYTLKEIGKAYTQWNEVIIATLIAIIFLTLFARRQRRQTHPMIDFSLFKKRYFSVGVAMSTLSMVIIVGIEFLLSQRLQLVAGFTPLNAALVILPIPIGSVLASPLAGFWLARLGAVRLIIIGFALTLMGNLWLIAISNSPIMLMGSLFLIGFGLGIIFTTASTSIMLSVDDKQAGMAASIEDIAYELGSVIGVTFMGSLMSTLYTLKLTLPDTLNVNSVVYDSLDEALIVAEKLPEAAATLLIAQANSAFEYAFSIVLIATAIVTTISLIALPYCLRNAVRENKPSH

Flanking regions ( +/- flanking 50bp)

TTATTATTCCTAGCTAAATATAACACCTAAGATAACCACTGAGACTTTATATGATAAAAGATTATAAGCGTTGGATAGTCTTACTTTTAGTATCAAGTATGCTGTTTCTAATTGTTGTTGATGTTACCGTACTTTATACCGCACTACCGCGTTTAACTCATGATCTCAATGCGAGCGCCTCAGAAAAACTATGGATCATGAATGCCTATCCGCTGATTGTCGCAGGGCTGTTGCCAGCAGCAGGTATGCTTACTGATAGAATAGGTCATAAGACGTTATTTATTAGCGGATTACCCCTTTTTGCCATCGCCTCATTATGTGCGGCTTATTCCCCTAGTGCCACCAGCTTAATTATTTCTCGTGGTTTCTTGGCCGTCGGTGCTGCTATGAGCATGCCTGCAACGTTGTCTATTGTGAGACAAGTATTTACTCATCCACAAGAGCGTGCCGTCGCCATCGGTATTTGGTCTGCTGTTGCTTCTGGTGGCGCGGCATTAGGGCCTTTAATTGGTGGGTTGCTATTAAACCATTTCTGGTGGGGCTCAGTCTTTTTGATCAATGTCCCTATTGTACTACTTGTGCTTCCTTTCTCGATTTGGCTAATTCCTCACTTTTCGGGACAACGGCAGCATAAAATTGATTATTTAAGCTCAATACTTATTTTGATTGGCTTAGTCAGCGCTATTTATACCTTAAAAGAGATAGGTAAGGCTTATACACAATGGAATGAAGTGATCATCGCCACCCTTATTGCCATTATTTTTCTCACACTATTTGCGCGGCGCCAACGTCGTCAAACGCATCCAATGATTGATTTTAGCCTATTTAAAAAGCGCTATTTCAGTGTCGGTGTGGCAATGTCGACTCTTTCTATGGTGATCATCGTGGGTATTGAATTTCTGCTAAGCCAACGCTTACAGTTAGTCGCCGGCTTTACACCATTGAATGCAGCTTTAGTGATTTTACCTATCCCTATCGGCTCAGTATTAGCCTCTCCTTTGGCTGGGTTTTGGCTAGCGCGTTTAGGTGCAGTGCGCTTAATTATTATCGGATTCGCCCTAACATTAATGGGTAACTTATGGTTAATTGCCATTTCAAACTCACCGATAATGCTAATGGGTAGCCTCTTTTTGATTGGCTTTGGTTTAGGCATTATTTTTACCACCGCATCGACCTCTATTATGCTAAGTGTCGACGATAAACAAGCAGGTATGGCCGCTTCTATTGAAGATATCGCCTATGAGTTGGGTAGCGTGATTGGCGTGACATTTATGGGGAGTTTAATGAGCACTCTCTATACCTTAAAACTAACTTTACCGGATACGCTTAACGTCAATAGTGTCGTTTATGATAGTTTAGATGAAGCACTTATTGTCGCTGAAAAGCTTCCCGAAGCAGCGGCGACCCTCTTAATCGCACAGGCTAATAGTGCGTTTGAATATGCCTTTTCTATCGTTCTGATCGCCACAGCCATTGTGACTACAATAAGCTTAATTGCACTCCCTTATTGCTTGCGTAATGCGGTAAGAGAAAACAAGCCCAGCCACTAATTCAAGCTCATAGAAAACGCGCCGTTATGGCGCGTTTCTCACAAAATCAG