Homologs in group_242

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04385 FBDBKF_04385 30.7 Morganella morganii S1 cra catabolite repressor/activator
EHELCC_05675 EHELCC_05675 30.7 Morganella morganii S2 cra catabolite repressor/activator
NLDBIP_05995 NLDBIP_05995 30.7 Morganella morganii S4 cra catabolite repressor/activator
LHKJJB_02875 LHKJJB_02875 30.7 Morganella morganii S3 cra catabolite repressor/activator
HKOGLL_06350 HKOGLL_06350 30.7 Morganella morganii S5 cra catabolite repressor/activator
F4V73_RS08830 F4V73_RS08830 30.4 Morganella psychrotolerans cra catabolite repressor/activator
PMI_RS10250 PMI_RS10250 28.8 Proteus mirabilis HI4320 cra catabolite repressor/activator

Distribution of the homologs in the orthogroup group_242

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_242

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KM69 1.02e-40 148 29 6 296 1 fruR Fructose operon regulatory protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A2P8 1.22e-34 132 30 8 336 3 cra Catabolite repressor/activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P9 1.22e-34 132 30 8 336 3 cra Catabolite repressor/activator Salmonella typhi
P37077 2.25e-34 131 28 4 314 4 scrR Sucrose operon repressor Salmonella typhimurium
P0ACP4 1.83e-33 129 29 8 334 3 cra Catabolite repressor/activator Shigella flexneri
P0ACP1 1.83e-33 129 29 8 334 1 cra Catabolite repressor/activator Escherichia coli (strain K12)
P0ACP2 1.83e-33 129 29 8 334 3 cra Catabolite repressor/activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACP3 1.83e-33 129 29 8 334 3 cra Catabolite repressor/activator Escherichia coli O157:H7
P37076 7.57e-33 127 27 4 312 4 scrR Sucrose operon repressor Klebsiella pneumoniae
P44329 3.18e-20 93 27 5 318 3 rbsR Ribose operon repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5E4H9 7.07e-18 86 24 10 318 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EH86 7.53e-18 86 25 10 323 3 purR HTH-type transcriptional repressor PurR Aliivibrio salmonicida (strain LFI1238)
B5FF00 7.56e-18 86 23 9 318 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain MJ11)
Q7MJ57 1.07e-17 85 23 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain YJ016)
Q8DAQ5 1.07e-17 85 23 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain CMCP6)
P37947 1.19e-17 85 28 3 210 1 degA HTH-type transcriptional regulator DegA Bacillus subtilis (strain 168)
Q6LQB9 5.66e-17 84 23 10 321 3 purR HTH-type transcriptional repressor PurR Photobacterium profundum (strain SS9)
O87590 7.65e-17 83 24 10 336 4 celR HTH-type transcriptional regulator CelR Thermobifida fusca
B7VMG4 9.27e-17 83 22 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio atlanticus (strain LGP32)
P0ACQ3 9.62e-17 83 25 8 314 3 rbsR Ribose operon repressor Shigella flexneri
P0ACQ0 9.62e-17 83 25 8 314 1 rbsR Ribose operon repressor Escherichia coli (strain K12)
P0ACQ1 9.62e-17 83 25 8 314 3 rbsR Ribose operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ2 9.62e-17 83 25 8 314 3 rbsR Ribose operon repressor Escherichia coli O157:H7
Q9K6K2 5.94e-16 80 25 10 294 3 rbsR Ribose operon repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9CPA2 7.98e-16 80 24 6 332 3 rbsR Ribose operon repressor Pasteurella multocida (strain Pm70)
A6TA06 1.16e-15 80 23 8 317 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C3LN44 1.23e-15 80 22 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain M66-2)
Q9KRC1 1.23e-15 80 22 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7H0 1.23e-15 80 22 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7N1L2 1.29e-15 80 22 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio campbellii (strain ATCC BAA-1116)
P27871 1.4e-15 79 24 6 317 4 endR Probable HTH-type transcriptional regulator EndR Paenibacillus polymyxa
B5XWL8 3.5e-15 78 22 7 316 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae (strain 342)
Q45831 5.17e-15 78 24 7 293 4 regA HTH-type transcriptional regulator RegA Clostridium saccharobutylicum
P36944 7.45e-15 77 24 8 325 4 rbsR Ribose operon repressor Bacillus subtilis (strain 168)
P07760 8.76e-15 76 28 3 191 4 rbtR Ribitol operon repressor Klebsiella aerogenes
Q04939 1.14e-14 77 32 4 184 4 sacR Sucrose operon repressor Lactococcus lactis subsp. lactis
Q87QW9 1.44e-14 77 21 6 315 3 purR HTH-type transcriptional repressor PurR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7VL44 1.78e-14 76 24 7 313 3 purR HTH-type transcriptional repressor PurR Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F4D0 2.91e-14 75 23 7 315 3 purR HTH-type transcriptional repressor PurR Glaesserella parasuis serovar 5 (strain SH0165)
Q9CN88 3.83e-14 75 22 5 311 3 purR HTH-type transcriptional repressor PurR Pasteurella multocida (strain Pm70)
Q65TP0 1.19e-13 74 20 6 316 3 purR HTH-type transcriptional repressor PurR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P41030 2.03e-13 73 23 7 280 3 galS HTH-type transcriptional regulator GalS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A5UCM9 2.9e-13 73 22 9 316 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittEE)
Q4QL70 2.9e-13 73 22 9 316 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain 86-028NP)
Q8Z6P1 3.69e-13 72 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella typhi
B4T567 3.69e-13 72 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella newport (strain SL254)
B5F6L7 3.69e-13 72 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella agona (strain SL483)
A7ZMC4 4.99e-13 72 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O139:H28 (strain E24377A / ETEC)
A5UIZ0 5.15e-13 72 22 9 316 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittGG)
A6VNL0 5.87e-13 72 20 6 336 3 purR HTH-type transcriptional repressor PurR Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P0CL11 6.9e-13 72 23 6 280 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAQ4 6.9e-13 72 23 6 280 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain SL1344)
P25144 6.99e-13 72 24 6 281 1 ccpA Catabolite control protein A Bacillus subtilis (strain 168)
P50844 7.16e-13 72 22 7 318 1 kdgR HTH-type transcriptional regulator KdgR Bacillus subtilis (strain 168)
Q8FH72 7.75e-13 72 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5BKD9 8.43e-13 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain AKU_12601)
Q5PH15 8.43e-13 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P46828 8.79e-13 71 26 10 303 1 ccpA Catabolite control protein A Priestia megaterium
Q1RBD7 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain UTI89 / UPEC)
Q0THG9 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABJ9 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O1:K1 / APEC
B7MVD4 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O81 (strain ED1a)
B7MA12 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URZ9 9e-13 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A9MEJ1 9.79e-13 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32FB3 1.04e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella dysenteriae serotype 1 (strain Sd197)
P0ACP9 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella flexneri
Q0T4B4 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella flexneri serotype 5b (strain 8401)
Q321B7 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 4 (strain Sb227)
B2U2G3 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
O68446 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUY8 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella schwarzengrund (strain CVM19633)
C0Q5V2 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi C (strain RKS4594)
A9N0Y2 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TH70 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella heidelberg (strain SL476)
B5RAM9 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV29 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella enteritidis PT4 (strain P125109)
B5FIH3 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella dublin (strain CT_02021853)
Q57PK6 1.14e-12 71 20 5 312 3 purR HTH-type transcriptional repressor PurR Salmonella choleraesuis (strain SC-B67)
B1LEM6 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SMS-3-5 / SECEC)
B6IB98 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SE11)
B7NBB1 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACP7 1.14e-12 71 22 10 336 1 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12)
B1IQ96 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0K5 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O9:H4 (strain HS)
C4ZYC2 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0L5 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O8 (strain IAI1)
B7NTX5 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z492 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACP8 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7
B7L5L1 1.14e-12 71 22 10 336 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain 55989 / EAEC)
B3H1F6 1.21e-12 71 21 6 314 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0H9 1.21e-12 71 21 6 314 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q88HH7 1.23e-12 71 26 1 163 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B7LQA9 1.37e-12 71 21 8 332 3 purR HTH-type transcriptional repressor PurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4EWM9 1.73e-12 70 21 8 317 3 purR HTH-type transcriptional repressor PurR Proteus mirabilis (strain HI4320)
Q3Z213 1.81e-12 70 22 10 336 3 purR HTH-type transcriptional repressor PurR Shigella sonnei (strain Ss046)
Q7N3V8 2.52e-12 70 22 8 317 3 purR HTH-type transcriptional repressor PurR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BE45 2.74e-12 70 20 8 316 3 purR HTH-type transcriptional repressor PurR Edwardsiella ictaluri (strain 93-146)
B0BP99 2.96e-12 70 21 6 314 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P18811 4.03e-12 69 27 6 203 2 malI Maltose regulon regulatory protein MalI Escherichia coli (strain K12)
Q56201 5.57e-12 69 26 10 336 4 malR HTH-type transcriptional regulator MalR Staphylococcus xylosus
C6DK36 6.88e-12 68 22 8 317 3 purR HTH-type transcriptional repressor PurR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P46456 7.26e-12 68 22 9 316 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
G3XD97 7.37e-12 68 24 1 163 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7MFD3 8.21e-12 68 21 7 314 3 purR HTH-type transcriptional repressor PurR Cronobacter sakazakii (strain ATCC BAA-894)
P72469 1.18e-11 68 24 11 329 4 reg1 HTH-type transcriptional regulator reg1 Streptomyces lividans
B2VEM5 1.19e-11 68 22 7 315 3 purR HTH-type transcriptional repressor PurR Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P25748 1.21e-11 68 22 7 317 1 galS HTH-type transcriptional regulator GalS Escherichia coli (strain K12)
Q54430 1.96e-11 67 28 3 174 4 scrR Sucrose operon repressor Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6D5W3 2.02e-11 67 22 8 317 3 purR HTH-type transcriptional repressor PurR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B0UUN7 2.14e-11 67 21 8 315 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 2336)
A8GDV6 2.74e-11 67 20 7 315 3 purR HTH-type transcriptional repressor PurR Serratia proteamaculans (strain 568)
Q0I4B4 3.24e-11 67 21 8 315 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 129Pt)
Q1C774 4.48e-11 66 20 7 316 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Antiqua)
A0A167V873 4.75e-11 66 24 1 163 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas plecoglossicida
P96158 8.21e-11 62 34 4 135 4 malI Maltose regulon regulatory protein MalI (Fragment) Vibrio furnissii
A1JP52 8.79e-11 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9KNI6 9.41e-11 65 23 8 325 2 Cphy_2742 HTH-type transcriptional regulator Cphy_2742 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B1JJ59 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66A32 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIQ4 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pestis (strain Pestoides F)
Q1CIL0 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZB3 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Angola)
Q7CIS2 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pestis
B2K5I4 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHK2 1.13e-10 65 21 8 317 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P03024 1.23e-10 65 22 6 280 1 galR HTH-type transcriptional regulator GalR Escherichia coli (strain K12)
P72396 1.6e-10 65 23 11 328 4 malR HTH-type transcriptional regulator MalR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8NW33 1.86e-10 64 24 2 187 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MW2)
Q6G8J1 1.86e-10 64 24 2 187 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MSSA476)
P99175 1.86e-10 64 24 2 187 1 ccpA Catabolite control protein A Staphylococcus aureus (strain N315)
P67655 1.86e-10 64 24 2 187 3 ccpA Catabolite control protein A Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HF38 1.86e-10 64 24 2 187 3 ccpA Catabolite control protein A Staphylococcus aureus (strain COL)
P0A4T2 2.55e-10 64 25 6 275 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4T1 2.55e-10 64 25 6 275 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6GFX2 3.74e-10 63 24 2 187 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MRSA252)
P58258 8.88e-10 62 30 1 129 3 regA HTH-type transcriptional regulator RegA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9JMQ1 1.13e-09 62 26 10 292 2 exuR Probable HTH-type transcriptional repressor ExuR Bacillus subtilis (strain 168)
P24242 1.9e-09 61 22 7 334 1 ascG HTH-type transcriptional regulator AscG Escherichia coli (strain K12)
O07329 3.05e-09 61 25 7 218 3 ccpA Catabolite control protein A Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q56194 5.23e-09 60 23 2 187 3 ccpA Catabolite control protein A Staphylococcus xylosus
Q8CNV8 5.33e-09 60 23 2 187 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNH3 5.33e-09 60 23 2 187 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P43472 1.25e-08 59 26 6 203 3 scrR Sucrose operon repressor Pediococcus pentosaceus
O07567 1.44e-08 58 20 5 329 4 ntdR NTD biosynthesis operon regulator NtdR Bacillus subtilis (strain 168)
P0ACP0 2.82e-08 58 21 10 338 3 cytR HTH-type transcriptional repressor CytR Shigella flexneri
P0ACN7 2.82e-08 58 21 10 338 1 cytR HTH-type transcriptional repressor CytR Escherichia coli (strain K12)
P0ACN8 2.82e-08 58 21 10 338 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACN9 2.82e-08 58 21 10 338 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O157:H7
P31766 3.42e-08 57 20 9 334 4 galR HTH-type transcriptional regulator GalR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CF41 3.66e-08 57 28 4 172 3 rbsR Ribose operon repressor Lactococcus lactis subsp. lactis (strain IL1403)
Q05954 5.82e-08 57 20 11 344 4 SCO4158 Uncharacterized HTH-type transcriptional regulator SCO4158 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O05103 1.42e-07 55 21 7 335 4 None HTH-type transcriptional regulator MalR Clostridium butyricum
Q48544 5.33e-07 54 23 3 172 4 pepR1 HTH-type transcriptional regulator pepR1 Lactobacillus delbrueckii subsp. lactis
P21867 5.38e-07 54 30 3 128 1 rafR HTH-type transcriptional regulator RafR Escherichia coli
P23823 4.1e-06 51 22 11 326 4 None Uncharacterized HTH-type transcriptional regulator in aml 5'region Streptomyces limosus
P74892 1.47e-05 49 22 5 208 4 scrR Sucrose operon repressor Staphylococcus xylosus
Q9I1F6 1.92e-05 49 18 4 316 1 gntR HTH-type transcriptional regulator GntR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A2C5 4.63e-05 48 25 11 254 1 rbsB Ribose import binding protein RbsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2C6 4.63e-05 48 25 11 254 3 rbsB Ribose import binding protein RbsB Salmonella typhi
O31690 6.99e-05 47 24 1 130 4 ykvZ Uncharacterized HTH-type transcriptional regulator YkvZ Bacillus subtilis (strain 168)
P0ACP5 7.74e-05 47 22 4 244 1 gntR HTH-type transcriptional regulator GntR Escherichia coli (strain K12)
P0ACP6 7.74e-05 47 22 4 244 3 gntR HTH-type transcriptional regulator GntR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44737 0.000114 47 26 7 172 1 rbsB Ribose import binding protein RbsB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9Z3R4 0.000141 47 26 10 299 4 aglR HTH-type transcriptional regulator AglR Rhizobium meliloti (strain 1021)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14505
Feature type CDS
Gene -
Product LacI family DNA-binding transcriptional regulator
Location 3216187 - 3217191 (strand: -1)
Length 1005 (nucleotides) / 334 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_242
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF13407 Periplasmic binding protein domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1609 Transcription (K) K DNA-binding transcriptional regulator, LacI/PurR family

Protein Sequence

MAKTVEQIANDLNLSITTVRLVLNGKGDQYRISAKTQKKIADYVEVFGYTVNHAARSLKLNKTDTYGLVIPRLSNPFFAALAEKLEMHCHQIGCQLMISCTYGDIKNENKLVKSMDERNVDGIFIVSASRKNQQHHVKHRQKPLVFLDRDFSVSNAICVASDNCDSGAQLTKAMIQQDAPIHFFAGDALLPTIAARLRGYVQAIKAHYGDESHVTVSYAEHNTTKDGEQMMKQYLEQHRQIPSHFIASSLPILEGVLSAIRQTEGVIPAHINIGTFDDHVMLSFLPNNVWSMKQDETLLVEKAFEIMTAKIAGNVVKAPPLIKTQLIKRLIAGA

Flanking regions ( +/- flanking 50bp)

TCCGCCCTCATTGTTAGCAAAATGAGGGCAATATCAATGACGGAACATTAATGGCAAAAACAGTTGAACAAATTGCAAATGATCTGAATTTATCTATCACCACAGTACGATTAGTACTCAATGGTAAAGGTGATCAATATCGGATCAGTGCAAAAACCCAGAAAAAAATTGCTGATTATGTCGAAGTTTTTGGTTATACCGTTAACCATGCGGCAAGAAGCTTAAAACTCAATAAAACAGATACTTATGGTCTGGTTATTCCTCGGCTGTCCAACCCCTTCTTTGCTGCTTTAGCGGAAAAGTTAGAGATGCATTGTCACCAAATTGGTTGCCAGCTGATGATAAGTTGTACCTATGGTGATATTAAAAATGAAAATAAGCTCGTAAAGTCTATGGATGAGCGTAATGTTGATGGGATTTTTATTGTTTCAGCGAGTCGAAAAAATCAGCAACATCACGTTAAACATCGTCAAAAGCCTTTAGTGTTCTTAGATAGAGATTTTTCTGTTAGTAATGCAATTTGCGTGGCGTCTGATAACTGTGATAGTGGTGCACAATTAACGAAAGCGATGATACAGCAAGATGCGCCAATCCACTTTTTTGCCGGTGATGCTCTTCTTCCTACTATTGCAGCTCGTTTGCGCGGTTATGTTCAGGCGATCAAAGCCCATTATGGTGATGAAAGCCATGTAACCGTTTCCTATGCAGAACATAACACCACCAAAGATGGTGAACAGATGATGAAGCAATATCTTGAACAACATCGGCAGATCCCCAGTCATTTTATTGCCTCATCACTGCCCATTTTAGAAGGCGTATTAAGTGCTATTCGCCAAACAGAAGGTGTTATTCCCGCACATATCAATATAGGTACTTTTGATGATCACGTTATGTTAAGTTTTTTACCTAATAATGTCTGGTCAATGAAGCAAGATGAAACCTTATTGGTAGAAAAAGCCTTTGAAATCATGACTGCTAAGATAGCAGGTAACGTAGTGAAAGCGCCTCCATTAATTAAAACACAACTTATCAAACGCCTAATTGCAGGAGCATGAGTCAAATATCGTGATTATTCGCCTCACTTTGTGAGTAGAATAAGCTTTCT