Homologs in group_39

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00755 FBDBKF_00755 23.7 Morganella morganii S1 - Lipoprotein
FBDBKF_01755 FBDBKF_01755 24.2 Morganella morganii S1 - DUF5339 domain-containing protein
EHELCC_00790 EHELCC_00790 23.7 Morganella morganii S2 - Lipoprotein
EHELCC_02225 EHELCC_02225 24.2 Morganella morganii S2 - DUF5339 domain-containing protein
NLDBIP_01235 NLDBIP_01235 24.2 Morganella morganii S4 - DUF5339 domain-containing protein
NLDBIP_02670 NLDBIP_02670 23.7 Morganella morganii S4 - Lipoprotein
LHKJJB_00800 LHKJJB_00800 24.2 Morganella morganii S3 - DUF5339 domain-containing protein
LHKJJB_04185 LHKJJB_04185 23.7 Morganella morganii S3 - Lipoprotein
HKOGLL_00840 HKOGLL_00840 24.2 Morganella morganii S5 - DUF5339 domain-containing protein
HKOGLL_02860 HKOGLL_02860 23.7 Morganella morganii S5 - Lipoprotein
F4V73_RS04085 F4V73_RS04085 22.0 Morganella psychrotolerans - DUF5339 domain-containing protein
F4V73_RS06755 F4V73_RS06755 23.7 Morganella psychrotolerans - DUF5339 domain-containing protein
PMI_RS04815 PMI_RS04815 23.1 Proteus mirabilis HI4320 - DUF5339 domain-containing protein

Distribution of the homologs in the orthogroup group_39

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_39

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14080
Feature type CDS
Gene -
Product DUF5339 family protein
Location 3126939 - 3127241 (strand: 1)
Length 303 (nucleotides) / 100 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_39
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF17274 Family of unknown function (DUF5339)

Protein Sequence

MKSRWGISTLLLFVTTFSVQATTSQTCRVYFKEADKFLQYIATRDDLKQNMPEIKGNFEQNKKLISSSTLKEQKAICEKGMQELDNLNKMFGPKEATAKK

Flanking regions ( +/- flanking 50bp)

CACTTTTTATATAATTACCCTATGTCAAATCAGTTAGGTGAATTTAGAGCATGAAATCACGTTGGGGCATTAGCACATTACTTTTATTCGTCACCACATTTTCAGTCCAAGCGACTACATCACAAACTTGTCGGGTTTACTTTAAAGAAGCCGATAAATTCTTACAATATATTGCTACAAGAGATGACTTAAAACAGAACATGCCTGAAATAAAAGGTAATTTTGAACAAAATAAAAAGTTGATCAGTTCTTCCACCCTAAAAGAGCAAAAAGCAATTTGTGAAAAAGGAATGCAAGAGCTTGATAACCTTAACAAGATGTTTGGTCCAAAAGAAGCTACAGCAAAAAAATAAATATAAATAATGACTAAATAATAAATAAGTGATTATATTTAGTCTTATTT