Homologs in group_1687

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11770 FBDBKF_11770 63.9 Morganella morganii S1 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase
EHELCC_14535 EHELCC_14535 63.9 Morganella morganii S2 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase
NLDBIP_15630 NLDBIP_15630 63.9 Morganella morganii S4 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase
LHKJJB_14980 LHKJJB_14980 63.9 Morganella morganii S3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase
HKOGLL_19305 HKOGLL_19305 63.9 Morganella morganii S5 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase
F4V73_RS14885 F4V73_RS14885 62.7 Morganella psychrotolerans fkpA FKBP-type peptidyl-prolyl cis-trans isomerase

Distribution of the homologs in the orthogroup group_1687

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1687

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P65764 3.03e-95 283 61 1 249 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P65765 3.03e-95 283 61 1 249 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Escherichia coli O157:H7
P45523 1.53e-91 273 61 1 249 1 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Escherichia coli (strain K12)
Q89A61 1.08e-68 214 42 2 248 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O08437 3.42e-59 191 39 2 259 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Aeromonas hydrophila
P57599 2.26e-57 186 45 1 231 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K943 1.11e-54 179 46 1 211 3 fkpA FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P44760 2.78e-50 167 45 4 209 1 HI_0574 Probable FKBP-type peptidyl-prolyl cis-trans isomerase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5ZXE0 1.4e-37 134 35 3 230 1 mip Outer membrane protein MIP Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q70YI1 1.48e-37 134 35 3 230 1 mip Outer membrane protein MIP Legionella pneumophila
A5IGB8 1.48e-37 134 35 3 230 3 mip Outer membrane protein MIP Legionella pneumophila (strain Corby)
P53605 1.12e-36 132 33 3 230 3 mip Outer membrane protein MIP Legionella longbeachae
P51752 2.74e-36 131 35 3 213 1 mip Peptidyl-prolyl cis-trans isomerase Mip Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q9JYI8 3.18e-36 132 39 3 205 1 fkpA Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A9L4 1.99e-34 125 38 4 210 3 fklB FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase Shigella flexneri
P0A9L3 1.99e-34 125 38 4 210 1 fklB FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli (strain K12)
P31106 8.3e-34 125 34 3 213 3 mip Outer membrane protein MIP Legionella micdadei
P56989 2.25e-25 99 54 2 96 3 fbp FK506-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0W3 4.5e-25 98 54 2 94 3 fbp FK506-binding protein Neisseria meningitidis serogroup C
P26623 7.36e-25 101 33 6 203 3 mip Peptidyl-prolyl cis-trans isomerase Mip Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P20080 1.16e-24 97 50 3 108 1 fkr-2 FK506-binding protein 1A Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P0A0W2 1.46e-24 97 53 2 96 1 fbp FK506-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9PJK1 1.33e-23 98 35 5 181 3 mip Peptidyl-prolyl cis-trans isomerase Mip Chlamydia muridarum (strain MoPn / Nigg)
Q4IN00 3.07e-21 90 52 2 89 3 FPR2 FK506-binding protein 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
O42993 3.1e-21 88 48 2 95 3 fkh1 Peptidyl-prolyl cis-trans isomerase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P48375 4.07e-21 88 49 3 99 3 Fkbp12 Peptidyl-prolyl cis-trans isomerase Fkbp12 Drosophila melanogaster
Q09734 2.44e-20 88 38 2 139 1 MIP Macrophage infectivity potentiator Trypanosoma cruzi
P0C1J5 8.07e-20 87 48 3 93 3 FKBP3 FK506-binding protein 2B Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q4WLV6 8.67e-20 84 45 3 105 1 fpr1A FK506-binding protein 1A Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q6CF41 1.11e-19 84 48 3 98 3 FPR1 FK506-binding protein 1 Yarrowia lipolytica (strain CLIB 122 / E 150)
P18203 1.48e-19 84 46 3 100 1 FKBP1A Peptidyl-prolyl cis-trans isomerase FKBP1A Bos taurus
Q4WHX4 2.36e-19 84 46 2 92 3 fpr2 FK506-binding protein 2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9Z7P3 2.66e-19 87 35 3 155 3 mip Peptidyl-prolyl cis-trans isomerase Mip Chlamydia pneumoniae
O60046 2.74e-19 86 46 2 89 1 fkr-5 FK506-binding protein 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P62943 3.41e-19 83 46 3 100 1 FKBP1A Peptidyl-prolyl cis-trans isomerase FKBP1A Oryctolagus cuniculus
P62942 3.41e-19 83 46 3 100 1 FKBP1A Peptidyl-prolyl cis-trans isomerase FKBP1A Homo sapiens
Q554J3 4.9e-19 82 47 2 95 3 fkbp1 FK506-binding protein 1 Dictyostelium discoideum
Q62658 6.09e-19 82 45 3 98 1 Fkbp1a Peptidyl-prolyl cis-trans isomerase FKBP1A Rattus norvegicus
Q5ATN7 6.25e-19 83 46 2 92 3 fkbB FK506-binding protein 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6CGG3 6.3e-19 83 40 2 120 3 FPR2 FK506-binding protein 2 Yarrowia lipolytica (strain CLIB 122 / E 150)
P26883 8.81e-19 82 45 3 100 1 Fkbp1a Peptidyl-prolyl cis-trans isomerase FKBP1A Mus musculus
Q6BX45 9.8e-19 82 48 3 97 3 FPR1 FK506-binding protein 1 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
P45878 1.15e-18 82 50 2 89 1 Fkbp2 Peptidyl-prolyl cis-trans isomerase FKBP2 Mus musculus
P26885 1.3e-18 82 50 2 89 1 FKBP2 Peptidyl-prolyl cis-trans isomerase FKBP2 Homo sapiens
Q32PA9 1.49e-18 82 50 2 89 2 FKBP2 Peptidyl-prolyl cis-trans isomerase FKBP2 Bos taurus
Q6FMA3 1.57e-18 81 46 3 99 1 FPR1 FK506-binding protein 1 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q86ZF2 1.94e-18 83 47 3 99 3 FPR2 FK506-binding protein 2 Podospora anserina
Q64378 2.06e-18 87 42 3 113 1 Fkbp5 Peptidyl-prolyl cis-trans isomerase FKBP5 Mus musculus
Q13451 2.44e-18 87 42 3 113 1 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Homo sapiens
Q9XSH5 2.46e-18 87 42 3 113 1 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Saimiri boliviensis boliviensis
Q5RF88 3.01e-18 86 42 3 113 2 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Pongo abelii
O94746 3.88e-18 80 47 3 98 1 FRR1 FK506-binding protein 1 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q54SR7 4.27e-18 80 45 2 88 3 fkbp2 FK506-binding protein 2 Dictyostelium discoideum
P20081 5.22e-18 80 47 3 99 1 FPR1 FK506-binding protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q2UPT7 5.81e-18 80 47 2 89 3 fpr2 FK506-binding protein 2 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q2U316 6.58e-18 80 42 3 105 3 fpr1 FK506-binding protein 1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q43207 7.53e-18 85 48 2 94 1 FKBP70 70 kDa peptidyl-prolyl isomerase Triticum aestivum
Q43207 3.92e-06 50 34 3 98 1 FKBP70 70 kDa peptidyl-prolyl isomerase Triticum aestivum
Q43207 7.26e-05 47 30 3 97 1 FKBP70 70 kDa peptidyl-prolyl isomerase Triticum aestivum
Q95L05 8.19e-18 85 41 3 113 2 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Chlorocebus aethiops
Q9XSI2 8.59e-18 85 41 3 113 2 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Saguinus oedipus
P0CP94 1.1e-17 79 47 3 97 3 FPR1 FK506-binding protein 1 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP95 1.1e-17 79 47 3 97 3 FPR1 FK506-binding protein 1 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q9FJL3 1.35e-17 85 45 3 110 1 FKBP65 Peptidyl-prolyl cis-trans isomerase FKBP65 Arabidopsis thaliana
Q9FJL3 0.000695 44 33 4 98 1 FKBP65 Peptidyl-prolyl cis-trans isomerase FKBP65 Arabidopsis thaliana
Q5VVH2 1.51e-17 79 44 3 100 1 FKBP1C Peptidyl-prolyl cis-trans isomerase FKBP1C Homo sapiens
Q9XT11 2.22e-17 84 40 3 113 2 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Aotus nancymaae
Q9Z2I2 2.8e-17 78 44 3 100 1 Fkbp1b Peptidyl-prolyl cis-trans isomerase FKBP1B Mus musculus
G0SC91 3.16e-17 84 45 2 95 3 FPR4 FK506-binding protein 4 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
P68106 4.3e-17 77 43 3 100 1 FKBP1B Peptidyl-prolyl cis-trans isomerase FKBP1B Homo sapiens
P68107 4.3e-17 77 43 3 100 1 FKBP1B Peptidyl-prolyl cis-trans isomerase FKBP1B Bos taurus
Q6BP84 7.97e-17 77 44 1 87 3 FPR2 FK506-binding protein 2 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q38931 8.07e-17 82 46 2 94 1 FKBP62 Peptidyl-prolyl cis-trans isomerase FKBP62 Arabidopsis thaliana
Q38931 0.000202 45 32 4 97 1 FKBP62 Peptidyl-prolyl cis-trans isomerase FKBP62 Arabidopsis thaliana
P97534 8.23e-17 77 43 3 100 1 Fkbp1b Peptidyl-prolyl cis-trans isomerase FKBP1B Rattus norvegicus
Q754K8 1.53e-16 76 45 3 99 3 FPR1 FK506-binding protein 1 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q8HYX6 1.61e-16 76 43 3 100 3 FKBP1B Peptidyl-prolyl cis-trans isomerase FKBP1B Oryctolagus cuniculus
Q6KBA8 2.03e-16 75 44 3 99 3 fprA FK506-binding protein 1A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54NB6 2.11e-16 80 43 1 109 1 fkbp4 FK506-binding protein 4 Dictyostelium discoideum
Q38935 3.82e-16 76 41 2 91 2 FKBP15-1 Peptidyl-prolyl cis-trans isomerase FKBP15-1 Arabidopsis thaliana
Q0WRJ7 7.48e-16 77 33 1 122 1 FKBP20-2 Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic Arabidopsis thaliana
P0C1J3 1.01e-15 73 44 3 98 3 FKBP1 FK506-binding protein 1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
O42123 1.49e-15 73 42 3 98 3 fkbp1a Peptidyl-prolyl cis-trans isomerase FKBP1A Xenopus laevis
Q6CX30 1.65e-15 73 43 2 91 3 FPR1 FK506-binding protein 1 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q41649 1.74e-15 74 43 2 88 1 FKBP15 FK506-binding protein 2 Vicia faba
P27124 2.61e-15 78 40 3 108 1 FKBP4 Peptidyl-prolyl cis-trans isomerase FKBP4 Oryctolagus cuniculus
P30416 5.16e-15 77 40 3 108 1 Fkbp4 Peptidyl-prolyl cis-trans isomerase FKBP4 Mus musculus
P0CP96 7.33e-15 72 45 3 91 3 FPR2 FK506-binding protein 2 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP97 7.48e-15 72 45 3 91 3 FPR2 FK506-binding protein 2 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q38936 7.88e-15 73 43 2 88 2 FKBP15-2 Peptidyl-prolyl cis-trans isomerase FKBP15-2 Arabidopsis thaliana
Q9TRY0 1.19e-14 76 40 3 108 1 FKBP4 Peptidyl-prolyl cis-trans isomerase FKBP4 Bos taurus
Q4PIN7 2.22e-14 75 34 4 146 3 FPR4 FK506-binding protein 4 Ustilago maydis (strain 521 / FGSC 9021)
Q02790 2.42e-14 75 39 3 108 1 FKBP4 Peptidyl-prolyl cis-trans isomerase FKBP4 Homo sapiens
Q7SCN0 2.7e-14 75 42 2 96 3 fkr-4 FK506-binding protein 4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q4INZ9 2.76e-14 75 43 2 96 3 FPR4 FK506-binding protein 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q6FSC1 2.95e-14 70 46 3 89 3 FPR2 FK506-binding protein 2 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q4WMV5 3.88e-14 74 42 2 96 3 fpr4 FK506-binding protein 4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O74191 7.18e-14 73 36 4 146 1 fkbp39 FK506-binding protein 39 kDa Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P32472 7.76e-14 69 45 3 91 1 FPR2 Peptidyl-prolyl cis-trans isomerase FPR2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9QVC8 8.03e-14 73 39 3 108 1 Fkbp4 Peptidyl-prolyl cis-trans isomerase FKBP4 Rattus norvegicus
Q4HZB8 1.85e-13 68 43 3 97 3 FPR1 FK506-binding protein 1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q4W9R2 3.24e-13 67 43 5 106 3 fpr1B FK506-binding protein 1B Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2UN37 3.33e-13 72 40 2 96 3 fpr4 FK506-binding protein 4 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P28870 4.29e-13 67 43 4 102 1 RBP1 FK506-binding protein 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6CUZ8 7.7e-13 67 41 4 107 3 FPR2 FK506-binding protein 2 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9SCY2 1.26e-12 68 36 3 117 1 FKBP13 Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic Arabidopsis thaliana
Q2YDL5 1.34e-12 68 40 4 102 2 FKBP11 Peptidyl-prolyl cis-trans isomerase FKBP11 Bos taurus
P0CP98 1.46e-12 70 40 2 105 3 FPR4 FK506-binding protein 4 Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CP99 1.46e-12 70 40 2 105 3 FPR4 FK506-binding protein 4 Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q9FLB3 1.72e-12 66 42 3 98 2 FKBP15-3 Peptidyl-prolyl cis-trans isomerase FKBP15-3 Arabidopsis thaliana
P28725 2.02e-12 65 36 3 98 1 fkbP FK506-binding protein Streptomyces anulatus
Q9Z247 2.2e-12 69 35 1 89 1 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Mus musculus
Q9Z247 7.68e-08 56 34 2 90 1 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Mus musculus
Q9Z247 8.58e-08 55 32 2 101 1 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Mus musculus
Q9Z247 8.74e-08 55 34 2 93 1 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Mus musculus
Q8I4V8 2.33e-12 68 37 5 122 1 FKBP35 Peptidyl-prolyl cis-trans isomerase FKBP35 Plasmodium falciparum (isolate 3D7)
P0C1J6 2.76e-12 68 40 3 112 3 FKBP4 FK506-binding protein 4 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q6BSE7 3.05e-12 68 38 2 95 3 FPR3 FK506-binding protein 3 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
P42458 3.16e-12 65 37 1 93 3 Cgl0830 Probable FK506-binding protein Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0C1B0 3.3e-12 68 36 2 109 3 fpr4 FK506-binding protein 4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O95302 3.75e-12 68 37 1 89 1 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Homo sapiens
O95302 9.41e-08 55 33 2 101 1 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Homo sapiens
O95302 1.53e-07 55 34 2 88 1 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Homo sapiens
O95302 6.09e-07 53 34 2 93 1 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Homo sapiens
Q66H94 5.56e-12 68 35 1 89 2 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Rattus norvegicus
Q66H94 6.21e-08 56 33 2 101 2 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Rattus norvegicus
Q66H94 8.19e-08 56 34 2 93 2 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Rattus norvegicus
Q66H94 3.38e-07 54 33 2 90 2 Fkbp9 Peptidyl-prolyl cis-trans isomerase FKBP9 Rattus norvegicus
Q2KJC8 5.9e-12 68 37 1 89 2 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Bos taurus
Q2KJC8 9.09e-08 55 33 2 101 2 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Bos taurus
Q2KJC8 5.32e-07 53 32 2 88 2 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Bos taurus
Q2KJC8 3.39e-06 51 33 2 93 2 FKBP9 Peptidyl-prolyl cis-trans isomerase FKBP9 Bos taurus
Q10175 8.57e-12 67 41 2 95 1 SPAC27F1.06c Probable peptidyl-prolyl cis-trans isomerase C27F1.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5R941 2.68e-11 64 36 3 92 2 FKBP14 Peptidyl-prolyl cis-trans isomerase FKBP14 Pongo abelii
Q9NWM8 2.68e-11 64 36 3 92 1 FKBP14 Peptidyl-prolyl cis-trans isomerase FKBP14 Homo sapiens
P59024 4.96e-11 63 36 3 92 1 Fkbp14 Peptidyl-prolyl cis-trans isomerase FKBP14 Mus musculus
Q6CWE8 6.65e-11 65 40 2 96 3 FPR3 FK506-binding protein 3 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q756V1 8.15e-11 64 41 2 95 3 FPR3 FK506-binding protein 3 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q93ZG9 8.45e-11 64 42 4 96 1 FKBP53 Peptidyl-prolyl cis-trans isomerase FKBP53 Arabidopsis thaliana
Q59VR3 1.14e-10 64 37 2 96 3 FPR3 FK506-binding protein 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q54G21 1.26e-10 64 31 3 124 1 fkbp5 FK506-binding protein 5 Dictyostelium discoideum
P30417 1.31e-10 62 35 2 111 3 fkl Probable FKBP-type 25 kDa peptidyl-prolyl cis-trans isomerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2HJ89 1.53e-10 64 38 2 88 2 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Bos taurus
Q2HJ89 2.48e-09 60 36 1 88 2 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Bos taurus
Q2HJ89 3.04e-09 60 31 2 99 2 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Bos taurus
Q2HJ89 6.1e-09 59 34 2 105 2 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Bos taurus
Q06205 1.55e-10 63 40 2 96 1 FPR4 FK506-binding protein 4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9VL78 1.75e-10 63 36 3 104 1 Fkbp59 FK506-binding protein 59 Drosophila melanogaster
Q6C4C9 1.86e-10 63 35 2 96 3 FPR3 FK506-binding protein 3 Yarrowia lipolytica (strain CLIB 122 / E 150)
Q61576 2.32e-10 63 38 2 88 1 Fkbp10 Peptidyl-prolyl cis-trans isomerase FKBP10 Mus musculus
Q61576 6.05e-10 62 35 1 88 1 Fkbp10 Peptidyl-prolyl cis-trans isomerase FKBP10 Mus musculus
Q61576 1.48e-08 58 35 2 105 1 Fkbp10 Peptidyl-prolyl cis-trans isomerase FKBP10 Mus musculus
Q61576 1.99e-08 57 31 2 90 1 Fkbp10 Peptidyl-prolyl cis-trans isomerase FKBP10 Mus musculus
Q96AY3 3.43e-10 63 38 2 88 1 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Homo sapiens
Q96AY3 3.4e-09 60 35 1 88 1 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Homo sapiens
Q96AY3 5.51e-09 59 32 2 99 1 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Homo sapiens
Q96AY3 1.61e-08 58 33 2 105 1 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Homo sapiens
Q6FKH7 3.78e-10 62 38 2 96 3 FPR3 FK506-binding protein 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q9SCY3 8.7e-10 60 34 3 118 1 PNSL4 Photosynthetic NDH subunit of lumenal location 4, chloroplastic Arabidopsis thaliana
Q9NYL4 1.19e-09 59 35 4 102 1 FKBP11 Peptidyl-prolyl cis-trans isomerase FKBP11 Homo sapiens
P54397 1.31e-09 61 43 4 98 1 Fkbp39 39 kDa FK506-binding nuclear protein Drosophila melanogaster
P38911 2.12e-09 60 38 2 97 1 FPR3 Peptidyl-prolyl cis-trans isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9D1M7 2.21e-09 58 37 3 87 1 Fkbp11 Peptidyl-prolyl cis-trans isomerase FKBP11 Mus musculus
P26884 3.5e-09 58 37 4 100 1 FKBP3 Peptidyl-prolyl cis-trans isomerase FKBP3 Bos taurus
Q6FK71 3.58e-09 60 37 2 95 3 FPR4 FK506-binding protein 4 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O46638 3.9e-09 58 37 3 100 2 FKBP3 Peptidyl-prolyl cis-trans isomerase FKBP3 Oryctolagus cuniculus
Q62446 4.01e-09 58 37 3 100 1 Fkbp3 Peptidyl-prolyl cis-trans isomerase FKBP3 Mus musculus
O81864 4.85e-09 58 31 4 127 2 FKBP17-1 Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic Arabidopsis thaliana
Q26486 5.62e-09 59 43 4 88 2 FKBP46 46 kDa FK506-binding nuclear protein Spodoptera frugiperda
O22870 7.68e-09 57 36 3 112 1 FKBP16-3 Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic Arabidopsis thaliana
Q6M981 1.14e-08 55 37 3 99 3 fkr-3 FK506-binding protein 1B Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q00688 2.32e-08 56 34 3 100 1 FKBP3 Peptidyl-prolyl cis-trans isomerase FKBP3 Homo sapiens
Q54N80 1.14e-07 53 36 2 97 2 fkbp3 FK506-binding protein 3 Dictyostelium discoideum
Q5T1M5 5.05e-07 53 38 3 92 1 FKBP15 FK506-binding protein 15 Homo sapiens
F4J9Q6 5.18e-07 53 35 4 95 1 FKBP43 Peptidyl-prolyl cis-trans isomerase FKBP43 Arabidopsis thaliana
P0CY37 5.74e-07 50 36 6 119 3 FKBP3 FK506-binding protein 1B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9M2S7 8.59e-07 51 36 4 92 1 FKBP20-1 Peptidyl-prolyl cis-trans isomerase FKBP20-1 Arabidopsis thaliana
O54998 1.63e-06 50 33 5 118 1 Fkbp7 Peptidyl-prolyl cis-trans isomerase FKBP7 Mus musculus
A1B0F4 6.85e-06 50 32 2 100 3 tig Trigger factor Paracoccus denitrificans (strain Pd 1222)
Q9Y680 6.94e-06 49 33 4 118 1 FKBP7 Peptidyl-prolyl cis-trans isomerase FKBP7 Homo sapiens
Q5RET2 8.15e-06 48 35 3 97 2 FKBP7 Peptidyl-prolyl cis-trans isomerase FKBP7 Pongo abelii
Q9LDY5 1.07e-05 48 30 5 117 1 FKBP17-2 Peptidyl-prolyl cis-trans isomerase FKBP17-2, chloroplastic Arabidopsis thaliana
Q9LYR5 1.53e-05 48 30 5 140 1 FKBP19 Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic Arabidopsis thaliana
Q8LGG0 1.67e-05 46 33 4 106 1 FKBP12 Peptidyl-prolyl cis-trans isomerase FKBP12 Arabidopsis thaliana
Q6P9Q6 1.98e-05 48 34 3 92 1 Fkbp15 FK506-binding protein 15 Mus musculus
F6PHZ6 2.08e-05 48 32 6 128 1 FKBP6 Inactive peptidyl-prolyl cis-trans isomerase FKBP6 Equus caballus
A6QQ71 2.34e-05 48 32 6 128 2 FKBP6 Inactive peptidyl-prolyl cis-trans isomerase FKBP6 Bos taurus
Q944B0 2.53e-05 47 31 3 125 2 FKBP16-1 Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic Arabidopsis thaliana
O75344 4.88e-05 47 31 6 128 1 FKBP6 Inactive peptidyl-prolyl cis-trans isomerase FKBP6 Homo sapiens
O04287 8e-05 44 34 4 102 1 FKBP12 Peptidyl-prolyl cis-trans isomerase FKBP12 Vicia faba
Q9LM71 9.87e-05 45 47 1 46 1 FKBP18 Peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic Arabidopsis thaliana
Q54Y27 0.000114 46 31 2 95 3 fkbp6 FK506-binding protein 6 Dictyostelium discoideum
D3ZQF4 0.000153 45 33 8 128 3 Fkbp6 Inactive peptidyl-prolyl cis-trans isomerase FKBP6 Rattus norvegicus
Q9SR70 0.000179 45 35 0 53 1 FKBP16-4 Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic Arabidopsis thaliana
Q75LS8 0.00087 42 40 1 45 5 FKBP9P1 Putative FK506-binding protein 9-like protein Homo sapiens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13835
Feature type CDS
Gene fkpA
Product FKBP-type peptidyl-prolyl cis-trans isomerase
Location 3073801 - 3074550 (strand: -1)
Length 750 (nucleotides) / 249 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1687
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00254 FKBP-type peptidyl-prolyl cis-trans isomerase
PF01346 Domain amino terminal to FKBP-type peptidyl-prolyl isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0545 Posttranslational modification, protein turnover, chaperones (O) O FKBP-type peptidyl-prolyl cis-trans isomerase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03772 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC:5.2.1.8] - -

Protein Sequence

MKSLLKTTLLATSLAFAFSAPHALAEETAKVPTLNSAFKTQDEQNAYALGASMGRYMEAALTEQKNIGINLDSKQLLAGVQDAFNNKSKLSDAEIELTLAAFEDQVRTVATAKMEKEAAENKAAGDKFRTEFAAEKGVVKTKSGLLYLVENPGKGKTPTDADRVTVNYKGMLIDGKQFDSSYDRKEPLTISLKSVIPGWTEGMKYIKEGGKIKLVIPPELGYGQRATSGIPANSTLVFEVELLSVESDK

Flanking regions ( +/- flanking 50bp)

ATGATCGTTTGCAACGCGTAGTGACTCACTAACATAAACTGGAGAACGGGATGAAATCTTTATTAAAAACGACGTTGTTGGCAACAAGTTTAGCATTTGCATTTAGTGCACCTCATGCACTGGCAGAAGAGACAGCTAAAGTACCAACATTAAATAGCGCGTTTAAAACTCAGGATGAGCAGAATGCATATGCTTTAGGCGCGTCAATGGGTCGCTATATGGAAGCTGCATTAACAGAACAAAAAAATATCGGTATTAATTTAGATTCAAAACAATTATTAGCCGGTGTTCAAGATGCCTTTAATAATAAATCTAAATTATCAGATGCAGAAATTGAATTAACGCTGGCAGCTTTTGAAGATCAAGTACGTACGGTTGCAACGGCGAAAATGGAAAAAGAAGCTGCAGAGAATAAAGCTGCTGGTGATAAATTCCGTACAGAATTTGCGGCTGAAAAAGGTGTTGTTAAAACTAAATCAGGCCTACTGTATTTAGTTGAAAATCCAGGTAAAGGTAAAACACCAACAGATGCCGATCGCGTTACTGTGAACTATAAAGGTATGCTGATTGACGGTAAACAATTTGATAGTTCTTATGATCGTAAAGAGCCTTTAACTATTAGCCTGAAAAGTGTTATCCCAGGTTGGACTGAAGGTATGAAATACATTAAAGAAGGCGGAAAAATTAAGTTAGTTATTCCACCTGAATTAGGTTACGGTCAACGTGCAACGAGTGGCATTCCAGCTAACTCAACATTAGTCTTTGAAGTTGAATTGCTGAGTGTTGAAAGCGACAAATAATCAGTTGCTTAATGAAAAAATGCTGGAGTACTATTCCAGCATTTTTGTTT