Homologs in group_2285

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17555 FBDBKF_17555 93.7 Morganella morganii S1 rplK 50S ribosomal protein L11
EHELCC_18040 EHELCC_18040 93.7 Morganella morganii S2 rplK 50S ribosomal protein L11
NLDBIP_18110 NLDBIP_18110 93.7 Morganella morganii S4 rplK 50S ribosomal protein L11
LHKJJB_18305 LHKJJB_18305 93.7 Morganella morganii S3 rplK 50S ribosomal protein L11
HKOGLL_17895 HKOGLL_17895 93.7 Morganella morganii S5 rplK 50S ribosomal protein L11
F4V73_RS14940 F4V73_RS14940 90.8 Morganella psychrotolerans rplK 50S ribosomal protein L11

Distribution of the homologs in the orthogroup group_2285

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2285

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYV3 2.74e-99 284 100 0 142 3 rplK Large ribosomal subunit protein uL11 Proteus mirabilis (strain HI4320)
P10055 9.11e-96 275 95 0 142 3 rplK Large ribosomal subunit protein uL11 Proteus vulgaris
C5BHE0 9.13e-95 272 93 0 142 3 rplK Large ribosomal subunit protein uL11 Edwardsiella ictaluri (strain 93-146)
Q2NWS0 1.2e-94 272 92 0 142 3 rplK Large ribosomal subunit protein uL11 Sodalis glossinidius (strain morsitans)
P09763 2.68e-94 271 92 0 142 3 rplK Large ribosomal subunit protein uL11 Serratia marcescens
A8G8E3 3.68e-94 271 92 0 142 3 rplK Large ribosomal subunit protein uL11 Serratia proteamaculans (strain 568)
C6DHR1 6.66e-94 270 92 0 142 3 rplK Large ribosomal subunit protein uL11 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VG92 1.75e-93 269 91 0 142 3 rplK Large ribosomal subunit protein uL11 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P60103 2.4e-93 269 91 0 141 3 rplK Large ribosomal subunit protein uL11 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9QZM4 2.71e-93 268 92 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Angola)
Q6DAN4 3.34e-93 268 90 0 142 3 rplK Large ribosomal subunit protein uL11 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5XYF9 9.07e-93 267 90 0 142 3 rplK Large ribosomal subunit protein uL11 Klebsiella pneumoniae (strain 342)
B1JJJ4 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ6 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS33 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis (strain Pestoides F)
Q1CN82 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAP1 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis
B2K108 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1T7 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI7 9.37e-93 267 91 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YV01 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella sonnei (strain Ss046)
Q0SY17 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella flexneri serotype 5b (strain 8401)
Q32AF5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella dysenteriae serotype 1 (strain Sd197)
B2TWG9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7K0 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7K1 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella typhi
B4TQJ1 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella schwarzengrund (strain CVM19633)
B5BJP9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi A (strain AKU_12601)
C0Q2R3 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi C (strain RKS4594)
Q5PK81 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella newport (strain SL254)
B4TCS0 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella heidelberg (strain SL476)
B5RFK5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD4 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella enteritidis PT4 (strain P125109)
B5FQJ5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella dublin (strain CT_02021853)
Q57H73 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella choleraesuis (strain SC-B67)
A9MHF7 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0W3 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Salmonella agona (strain SL483)
B7LUL9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5U7 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain UTI89 / UPEC)
B1LNT5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J3 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain SE11)
B7NFS3 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7J7 1.22e-92 267 89 0 142 1 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12)
B1IUR4 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7J8 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA82 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A782 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O9:H4 (strain HS)
B1XBY5 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12 / DH10B)
C5A0S3 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M730 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O8 (strain IAI1)
B7MRA9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O81 (strain ED1a)
B7NRR1 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z079 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O157:H7
B7LA74 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli (strain 55989 / EAEC)
B7MIW9 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPD8 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ6 1.22e-92 267 89 0 142 3 rplK Large ribosomal subunit protein uL11 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AKU4 1.93e-92 266 88 0 142 3 rplK Large ribosomal subunit protein uL11 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TGN5 2.11e-92 266 89 0 142 3 rplK Large ribosomal subunit protein uL11 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q83PC3 3.35e-92 266 88 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella flexneri
A1JIH6 3.86e-92 266 90 0 141 3 rplK Large ribosomal subunit protein uL11 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q31U14 5.02e-92 265 88 0 142 3 rplK Large ribosomal subunit protein uL11 Shigella boydii serotype 4 (strain Sb227)
A7MQQ0 5.73e-92 265 89 0 142 3 rplK Large ribosomal subunit protein uL11 Cronobacter sakazakii (strain ATCC BAA-894)
A4W5A3 7.47e-91 262 87 0 142 3 rplK Large ribosomal subunit protein uL11 Enterobacter sp. (strain 638)
Q65W46 7.57e-90 260 89 0 142 3 rplK Large ribosomal subunit protein uL11 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UH22 2.89e-89 258 88 0 142 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain PittGG)
A6VKC9 3.15e-89 258 87 0 142 3 rplK Large ribosomal subunit protein uL11 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44351 4.57e-89 258 88 0 142 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5U9X6 4.57e-89 258 88 0 142 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain PittEE)
Q4QN31 4.57e-89 258 88 0 142 3 rplK Large ribosomal subunit protein uL11 Haemophilus influenzae (strain 86-028NP)
Q9CK85 6.57e-89 258 86 0 142 3 rplK Large ribosomal subunit protein uL11 Pasteurella multocida (strain Pm70)
B0UUZ4 9.33e-89 257 87 0 141 3 rplK Large ribosomal subunit protein uL11 Histophilus somni (strain 2336)
Q0I0V2 9.33e-89 257 87 0 141 3 rplK Large ribosomal subunit protein uL11 Histophilus somni (strain 129Pt)
B5FC92 1.9e-88 256 88 0 141 3 rplK Large ribosomal subunit protein uL11 Aliivibrio fischeri (strain MJ11)
Q5E232 1.9e-88 256 88 0 141 3 rplK Large ribosomal subunit protein uL11 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MXE5 4.84e-88 255 88 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio campbellii (strain ATCC BAA-1116)
P60105 7.34e-88 255 87 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio vulnificus (strain YJ016)
Q87KQ0 1.42e-87 254 87 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6ENR7 2.89e-87 253 85 0 141 3 rplK Large ribosomal subunit protein uL11 Aliivibrio salmonicida (strain LFI1238)
P62440 3.13e-87 253 87 0 141 3 rplK Large ribosomal subunit protein uL11 Photobacterium profundum (strain SS9)
O32613 3.72e-87 253 85 0 142 3 rplK Large ribosomal subunit protein uL11 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B3GYU4 3.72e-87 253 85 0 142 3 rplK Large ribosomal subunit protein uL11 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N316 3.72e-87 253 85 0 142 3 rplK Large ribosomal subunit protein uL11 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F7D2 9.36e-87 252 85 0 142 3 rplK Large ribosomal subunit protein uL11 Glaesserella parasuis serovar 5 (strain SH0165)
Q8DD24 9.47e-87 252 86 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio vulnificus (strain CMCP6)
C3LR56 5.43e-84 245 82 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV34 5.43e-84 245 82 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P1 5.43e-84 245 82 0 141 3 rplK Large ribosomal subunit protein uL11 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B1KMZ4 8.44e-82 239 81 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella woodyi (strain ATCC 51908 / MS32)
A8GYW5 8.44e-82 239 81 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3Q971 1.41e-81 239 81 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM23 2.47e-81 238 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella halifaxensis (strain HAW-EB4)
A1S207 4.09e-81 238 79 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q089R5 4.19e-81 238 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella frigidimarina (strain NCIMB 400)
A8G1F9 5.04e-81 238 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella sediminis (strain HAW-EB3)
B8CNC1 6.49e-81 237 80 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella piezotolerans (strain WP3 / JCM 13877)
A1REA3 1.45e-80 236 78 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain W3-18-1)
A4YBZ4 1.45e-80 236 78 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8KA66 2.98e-80 236 75 0 142 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9KW91 1.69e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS195)
A6WHR7 1.69e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS185)
B8EBL6 1.69e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella baltica (strain OS223)
Q8EK78 2.08e-78 231 78 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0I0B6 2.24e-78 231 78 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain MR-7)
Q0HNU8 2.24e-78 231 78 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain MR-4)
A0KRL3 2.24e-78 231 78 0 141 3 rplK Large ribosomal subunit protein uL11 Shewanella sp. (strain ANA-3)
A4SHU5 2.35e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Aeromonas salmonicida (strain A449)
A0KQA9 2.35e-78 231 78 0 142 3 rplK Large ribosomal subunit protein uL11 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4K4F5 6.58e-78 229 80 0 142 3 rplK Large ribosomal subunit protein uL11 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q47UV5 1.18e-77 229 78 0 142 3 rplK Large ribosomal subunit protein uL11 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1LSY1 2.48e-77 228 75 0 141 3 rplK Large ribosomal subunit protein uL11 Baumannia cicadellinicola subsp. Homalodisca coagulata
A1TYI6 2.56e-77 228 78 0 141 3 rplK Large ribosomal subunit protein uL11 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q12SX0 4.84e-77 228 77 0 142 3 rplK Large ribosomal subunit protein uL11 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3ILQ4 2.06e-76 226 77 0 142 3 rplK Large ribosomal subunit protein uL11 Pseudoalteromonas translucida (strain TAC 125)
C4LBV6 3.23e-76 225 78 0 141 3 rplK Large ribosomal subunit protein uL11 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q1R0I6 4.15e-76 225 77 0 141 3 rplK Large ribosomal subunit protein uL11 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8D6V4 1.07e-75 224 70 0 141 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57150 1.07e-75 224 70 0 141 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8K0 1.07e-75 224 70 0 141 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8GV69 3.93e-75 223 76 0 141 3 rplK Large ribosomal subunit protein uL11 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A5EX74 1.39e-74 221 74 0 142 3 rplK Large ribosomal subunit protein uL11 Dichelobacter nodosus (strain VCS1703A)
Q0VSM6 3.72e-74 220 75 0 141 3 rplK Large ribosomal subunit protein uL11 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3J8Q3 3.89e-74 220 73 0 141 3 rplK Large ribosomal subunit protein uL11 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q60A10 6.73e-74 219 74 0 141 3 rplK Large ribosomal subunit protein uL11 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2S901 6.95e-74 219 73 0 142 3 rplK Large ribosomal subunit protein uL11 Hahella chejuensis (strain KCTC 2396)
Q9HWC5 2.01e-73 218 74 0 141 1 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T91 2.01e-73 218 74 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V633 2.01e-73 218 74 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain LESB58)
A6UZH7 2.01e-73 218 74 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas aeruginosa (strain PA7)
Q0ABI6 2.2e-73 218 74 0 141 3 rplK Large ribosomal subunit protein uL11 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5QWA9 1.27e-72 216 74 0 141 3 rplK Large ribosomal subunit protein uL11 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C5BPQ2 1.91e-72 216 72 0 141 3 rplK Large ribosomal subunit protein uL11 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4XZA1 3.19e-72 215 73 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas mendocina (strain ymp)
C1DKK1 4.02e-72 215 72 0 141 3 rplK Large ribosomal subunit protein uL11 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q492B5 6.8e-72 214 70 0 140 3 rplK Large ribosomal subunit protein uL11 Blochmanniella pennsylvanica (strain BPEN)
Q47JB4 8.1e-72 214 72 0 141 3 rplK Large ribosomal subunit protein uL11 Dechloromonas aromatica (strain RCB)
Q31IZ3 8.56e-72 214 72 0 141 3 rplK Large ribosomal subunit protein uL11 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q15YB5 8.94e-72 214 75 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4VHL9 9.87e-72 214 73 0 141 3 rplK Large ribosomal subunit protein uL11 Stutzerimonas stutzeri (strain A1501)
Q9PA82 1.71e-71 213 71 0 141 3 rplK Large ribosomal subunit protein uL11 Xylella fastidiosa (strain 9a5c)
Q87A28 5.58e-71 212 70 0 141 3 rplK Large ribosomal subunit protein uL11 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B3PK26 5.96e-71 212 72 0 141 3 rplK Large ribosomal subunit protein uL11 Cellvibrio japonicus (strain Ueda107)
Q21M97 6.16e-71 212 72 0 141 3 rplK Large ribosomal subunit protein uL11 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6W3A3 6.58e-71 212 73 0 141 3 rplK Large ribosomal subunit protein uL11 Marinomonas sp. (strain MWYL1)
B1JE13 1.82e-70 211 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain W619)
Q88QP5 1.82e-70 211 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK56 1.82e-70 211 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain GB-1)
A5VXN6 1.82e-70 211 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3K5X7 2.99e-70 210 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain Pf0-1)
Q1IFX7 3.22e-70 210 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas entomophila (strain L48)
B0VDG6 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AYE)
A3M1F9 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VMA3 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain SDF)
B2I1Y7 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain ACICU)
B7I356 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AB0057)
B7H1K2 4.1e-70 210 72 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baumannii (strain AB307-0294)
C3K2Y7 4.94e-70 210 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain SBW25)
Q4K522 4.94e-70 210 71 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P60100 1.39e-69 209 71 0 141 3 rplK Large ribosomal subunit protein uL11 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6FF94 1.53e-69 209 71 0 141 3 rplK Large ribosomal subunit protein uL11 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4ZMN3 2.1e-69 208 70 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas syringae pv. syringae (strain B728a)
Q889Y2 2.1e-69 208 70 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A1WVD3 3.02e-69 208 71 0 141 3 rplK Large ribosomal subunit protein uL11 Halorhodospira halophila (strain DSM 244 / SL1)
Q48D25 3.44e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2FQ34 4.01e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Stenotrophomonas maltophilia (strain K279a)
B4SKV2 4.01e-69 207 70 0 141 3 rplK Large ribosomal subunit protein uL11 Stenotrophomonas maltophilia (strain R551-3)
A1KB38 4.33e-69 207 69 0 141 3 rplK Large ribosomal subunit protein uL11 Azoarcus sp. (strain BH72)
Q5P343 6.64e-69 207 69 0 141 3 rplK Large ribosomal subunit protein uL11 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q89B16 1.02e-68 206 62 0 142 3 rplK Large ribosomal subunit protein uL11 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8PNT4 1.28e-68 206 69 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas axonopodis pv. citri (strain 306)
Q5GWS1 1.69e-68 206 68 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQP7 1.69e-68 206 68 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX4 1.69e-68 206 68 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWZ5 1.69e-68 206 69 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A9M3X8 3.18e-68 205 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup C (strain 053442)
A9IJ32 3.92e-68 205 68 0 141 3 rplK Large ribosomal subunit protein uL11 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
C1DAQ6 3.96e-68 205 69 0 141 3 rplK Large ribosomal subunit protein uL11 Laribacter hongkongensis (strain HLHK9)
Q1H4P8 6.21e-68 204 70 0 141 3 rplK Large ribosomal subunit protein uL11 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B0RU93 1.02e-67 204 69 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain B100)
B4RQV8 1.09e-67 204 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5R1 1.09e-67 204 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8XUZ4 1.2e-67 204 67 0 141 3 rplK Large ribosomal subunit protein uL11 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B5ELW8 1.25e-67 204 68 0 141 3 rplK Large ribosomal subunit protein uL11 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J455 1.25e-67 204 68 0 141 3 rplK Large ribosomal subunit protein uL11 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A5WH39 1.28e-67 204 70 0 141 3 rplK Large ribosomal subunit protein uL11 Psychrobacter sp. (strain PRwf-1)
B2UF71 1.78e-67 203 66 0 141 3 rplK Large ribosomal subunit protein uL11 Ralstonia pickettii (strain 12J)
A1KRG2 1.94e-67 203 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JX02 1.94e-67 203 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K1J3 1.96e-67 203 70 0 141 3 rplK Large ribosomal subunit protein uL11 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q2L2N9 2.21e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Bordetella avium (strain 197N)
Q7W2H3 2.39e-67 203 67 0 141 3 rplK Large ribosomal subunit protein uL11 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE3 2.39e-67 203 67 0 141 3 rplK Large ribosomal subunit protein uL11 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2SU15 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PZ9 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain K96243)
A3NEJ1 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 668)
Q3JMP9 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 1710b)
A3P0C9 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia pseudomallei (strain 1106a)
A1V8B6 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain SAVP1)
Q62GJ3 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain ATCC 23344)
A2S7G2 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain NCTC 10229)
A3MRU1 2.47e-67 203 68 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia mallei (strain NCTC 10247)
B2JIH8 3.08e-67 202 67 0 141 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q3SF21 3.71e-67 202 68 0 141 3 rplK Large ribosomal subunit protein uL11 Thiobacillus denitrificans (strain ATCC 25259)
Q7W0S3 3.79e-67 202 67 0 141 3 rplK Large ribosomal subunit protein uL11 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q3A6Q8 4.42e-67 202 73 1 138 3 rplK Large ribosomal subunit protein uL11 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8RTJ5 6.28e-67 202 68 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URC8 6.28e-67 202 68 0 141 3 rplK Large ribosomal subunit protein uL11 Xanthomonas campestris pv. campestris (strain 8004)
Q46WD0 7.9e-67 202 67 0 141 3 rplK Large ribosomal subunit protein uL11 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C6C175 8.17e-67 202 71 1 142 3 rplK Large ribosomal subunit protein uL11 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q13TF8 8.43e-67 202 66 0 141 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia xenovorans (strain LB400)
Q5WZM3 1.08e-66 201 73 0 141 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Lens)
Q5ZYQ4 1.08e-66 201 73 0 141 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHS5 1.08e-66 201 73 0 141 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Corby)
Q5X870 1.08e-66 201 73 0 141 3 rplK Large ribosomal subunit protein uL11 Legionella pneumophila (strain Paris)
A9ADI1 1.1e-66 201 67 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia multivorans (strain ATCC 17616 / 249)
B3R7U0 1.12e-66 201 66 0 141 3 rplK Large ribosomal subunit protein uL11 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K602 1.12e-66 201 66 0 141 3 rplK Large ribosomal subunit protein uL11 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LI16 1.12e-66 201 66 0 141 3 rplK Large ribosomal subunit protein uL11 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1ALT0 2.05e-66 201 71 1 138 3 rplK Large ribosomal subunit protein uL11 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9M6V6 3.32e-66 200 71 1 138 3 rplK Large ribosomal subunit protein uL11 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q4FQG9 4.04e-66 200 68 0 141 3 rplK Large ribosomal subunit protein uL11 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A4JAM8 4.46e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ58 4.46e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRB8 4.46e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia ambifaria (strain MC40-6)
Q1BRT6 4.98e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia orbicola (strain AU 1054)
B1JU10 4.98e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia orbicola (strain MC0-3)
Q39KH9 4.98e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5A8 4.98e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3L3 4.98e-66 200 66 0 141 3 rplK Large ribosomal subunit protein uL11 Burkholderia cenocepacia (strain HI2424)
A4SUV0 5.43e-66 199 65 0 141 3 rplK Large ribosomal subunit protein uL11 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2T763 5.43e-66 199 65 0 141 3 rplK Large ribosomal subunit protein uL11 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q9KGE6 6e-66 199 71 1 142 3 rplK1 Large ribosomal subunit protein uL11A Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A6T3L7 6.62e-66 199 67 0 141 3 rplK Large ribosomal subunit protein uL11 Janthinobacterium sp. (strain Marseille)
Q1Q8P5 1.41e-65 199 67 0 141 3 rplK Large ribosomal subunit protein uL11 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A4G9U9 1.46e-65 198 67 0 141 3 rplK Large ribosomal subunit protein uL11 Herminiimonas arsenicoxydans
C6E4R8 1.49e-65 198 71 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter sp. (strain M21)
B5EFN9 1.49e-65 198 71 1 138 3 rplK Large ribosomal subunit protein uL11 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C5CKE9 2.41e-65 198 65 0 141 3 rplK Large ribosomal subunit protein uL11 Variovorax paradoxus (strain S110)
Q8ETZ3 5.61e-65 197 68 1 142 3 rplK Large ribosomal subunit protein uL11 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A9KD43 6.68e-65 197 66 1 142 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain Dugway 5J108-111)
B3E7S4 7.3e-65 197 68 1 138 3 rplK Large ribosomal subunit protein uL11 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q134R3 7.54e-65 197 66 0 141 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisB5)
Q2IXS8 7.62e-65 197 66 0 141 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain HaA2)
P62434 8.33e-65 196 68 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1YGT7 1.25e-64 196 68 1 142 3 rplK Large ribosomal subunit protein uL11 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q21SF3 1.26e-64 196 65 0 141 3 rplK Large ribosomal subunit protein uL11 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1AX79 1.26e-64 196 64 0 141 3 rplK Large ribosomal subunit protein uL11 Ruthia magnifica subsp. Calyptogena magnifica
B1XSE8 1.33e-64 196 64 0 141 3 rplK Large ribosomal subunit protein uL11 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q83ET4 1.39e-64 196 66 1 142 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL0 1.39e-64 196 66 1 142 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J275 1.39e-64 196 66 1 142 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain CbuG_Q212)
B6J5B8 1.39e-64 196 66 1 142 3 rplK Large ribosomal subunit protein uL11 Coxiella burnetii (strain CbuK_Q154)
C0ZIG5 1.42e-64 196 70 1 142 3 rplK Large ribosomal subunit protein uL11 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5WLS5 1.79e-64 196 69 1 142 3 rplK Large ribosomal subunit protein uL11 Shouchella clausii (strain KSM-K16)
B4S493 1.98e-64 196 68 1 142 3 rplK Large ribosomal subunit protein uL11 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B6JER5 2.02e-64 196 67 0 140 3 rplK Large ribosomal subunit protein uL11 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
P36254 2.23e-64 195 70 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus carnosus (strain TM300)
Q8D237 2.52e-64 195 59 0 142 3 rplK Large ribosomal subunit protein uL11 Wigglesworthia glossinidia brevipalpis
A9BR94 2.72e-64 195 64 0 141 3 rplK Large ribosomal subunit protein uL11 Delftia acidovorans (strain DSM 14801 / SPH-1)
A5GAX7 3.1e-64 195 68 1 138 3 rplK Large ribosomal subunit protein uL11 Geotalea uraniireducens (strain Rf4)
A2SLG9 3.2e-64 195 64 0 141 3 rplK Large ribosomal subunit protein uL11 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q211C4 3.42e-64 195 67 0 140 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisB18)
B3QC05 3.69e-64 195 67 0 141 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain TIE-1)
P62441 3.69e-64 195 67 0 141 1 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q03E48 3.86e-64 195 70 1 141 3 rplK Large ribosomal subunit protein uL11 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B4R8K1 4.91e-64 194 67 0 140 3 rplK Large ribosomal subunit protein uL11 Phenylobacterium zucineum (strain HLK1)
C4KZQ9 5.02e-64 194 67 1 142 3 rplK Large ribosomal subunit protein uL11 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C4XIP3 5.25e-64 194 68 1 138 3 rplK Large ribosomal subunit protein uL11 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q2YB09 6.53e-64 194 65 0 141 3 rplK Large ribosomal subunit protein uL11 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q123F9 6.6e-64 194 64 0 141 3 rplK Large ribosomal subunit protein uL11 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4YSH5 7.21e-64 194 66 0 140 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium sp. (strain ORS 278)
Q4L3J6 8.14e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus haemolyticus (strain JCSC1435)
Q8CTT5 8.14e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL5 8.14e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5L421 8.4e-64 194 67 1 142 3 rplK Large ribosomal subunit protein uL11 Geobacillus kaustophilus (strain HTA426)
P0A0F3 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MW2)
A8YZN5 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBV0 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MSSA476)
Q6GJD1 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain MRSA252)
P0A0F2 8.5e-64 194 69 1 141 1 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain N315)
P0A0F1 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQ91 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain JH9)
P0A0F4 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA3 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain USA300)
A6TZ14 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain JH1)
A7WYW0 8.5e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5HID8 8.88e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain COL)
A9VNB0 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus mycoides (strain KBAB4)
Q6HPS1 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HA3 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain ZK / E33L)
A7GK08 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQT1 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain AH187)
B7HJ35 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain B4264)
C1ET26 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain 03BB102)
B7IT06 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain G9842)
P62431 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKA5 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus cereus (strain AH820)
Q81VU3 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis
C3LJ69 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9P2 9.38e-64 194 68 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus anthracis (strain A0248)
Q2YSC4 9.59e-64 194 69 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A4XLK2 9.8e-64 194 67 1 142 3 rplK Large ribosomal subunit protein uL11 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A5ELP2 1.08e-63 194 66 0 140 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q81J53 1.39e-63 193 68 1 142 3 rplK1 Large ribosomal subunit protein uL11A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A1VTG2 1.55e-63 193 64 0 141 3 rplK Large ribosomal subunit protein uL11 Polaromonas naphthalenivorans (strain CJ2)
A4IJH6 1.55e-63 193 66 1 142 3 rplK Large ribosomal subunit protein uL11 Geobacillus thermodenitrificans (strain NG80-2)
C5D3Q4 1.71e-63 193 66 1 142 3 rplK Large ribosomal subunit protein uL11 Geobacillus sp. (strain WCH70)
A5CW29 2.3e-63 193 63 0 141 3 rplK Large ribosomal subunit protein uL11 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q89J69 2.38e-63 193 65 0 140 3 rplK Large ribosomal subunit protein uL11 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q0AF49 2.8e-63 192 65 0 141 3 rplK Large ribosomal subunit protein uL11 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B9MJX1 3e-63 192 66 1 142 3 rplK Large ribosomal subunit protein uL11 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q11HA9 3.09e-63 192 65 0 140 3 rplK Large ribosomal subunit protein uL11 Chelativorans sp. (strain BNC1)
Q07KJ7 3.57e-63 192 65 0 141 3 rplK Large ribosomal subunit protein uL11 Rhodopseudomonas palustris (strain BisA53)
Q1QN48 5.78e-63 192 66 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q38V05 5.91e-63 192 70 1 141 3 rplK Large ribosomal subunit protein uL11 Latilactobacillus sakei subsp. sakei (strain 23K)
A0AF47 6.11e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66054 6.11e-63 192 68 1 142 1 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DF07 6.11e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4a (strain HCC23)
Q724G4 6.11e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4b (strain F2365)
C1KYI0 6.11e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66055 6.11e-63 192 68 1 142 3 rplK Large ribosomal subunit protein uL11 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q18CE5 6.11e-63 192 69 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridioides difficile (strain 630)
B1Y7H7 6.66e-63 192 63 0 141 3 rplK Large ribosomal subunit protein uL11 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A0LII0 8.39e-63 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3A9Q2 1.06e-62 191 69 1 142 3 rplK Large ribosomal subunit protein uL11 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P60104 1.09e-62 191 64 0 141 3 rplK Large ribosomal subunit protein uL11 Gamma-proteobacterium EBAC31A08
Q82T71 1.15e-62 191 63 0 141 3 rplK Large ribosomal subunit protein uL11 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q49V47 1.15e-62 191 68 1 141 3 rplK Large ribosomal subunit protein uL11 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4IW95 1.23e-62 191 67 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NID6 1.23e-62 191 67 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q871 1.23e-62 191 67 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. novicida (strain U112)
B2SFD2 1.23e-62 191 67 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JT9 1.23e-62 191 67 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. tularensis (strain FSC 198)
Q65PC0 1.42e-62 191 70 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B1KT95 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ86 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGG6 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Okra / Type B1)
C1FMW3 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Kyoto / Type A2)
A5I7L8 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVR3 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ81 1.45e-62 191 68 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain ATCC 19397 / Type A)
Q0BKC0 1.69e-62 191 66 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1M3 1.69e-62 191 66 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC4 1.69e-62 191 66 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q39Y17 1.89e-62 191 65 1 138 3 rplK Large ribosomal subunit protein uL11 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B8HVL5 1.95e-62 191 64 1 142 3 rplK Large ribosomal subunit protein uL11 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q8KG19 2.3e-62 190 67 1 141 3 rplK Large ribosomal subunit protein uL11 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q1WST2 2.43e-62 190 69 1 142 3 rplK Large ribosomal subunit protein uL11 Ligilactobacillus salivarius (strain UCC118)
B3QQS6 2.56e-62 190 66 1 141 3 rplK Large ribosomal subunit protein uL11 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q035U8 2.68e-62 190 69 1 141 3 rplK Large ribosomal subunit protein uL11 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WA09 2.68e-62 190 69 1 141 3 rplK Large ribosomal subunit protein uL11 Lacticaseibacillus casei (strain BL23)
B0TC43 2.96e-62 190 69 1 138 3 rplK Large ribosomal subunit protein uL11 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A7Z0M4 3.41e-62 190 69 1 142 3 rplK Large ribosomal subunit protein uL11 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q06796 3.41e-62 190 69 1 142 1 rplK Large ribosomal subunit protein uL11 Bacillus subtilis (strain 168)
A3DIZ0 3.72e-62 190 65 1 142 3 rplK Large ribosomal subunit protein uL11 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q31QK3 3.89e-62 190 65 1 142 3 rplK Large ribosomal subunit protein uL11 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A8MLC8 3.89e-62 190 65 1 142 3 rplK Large ribosomal subunit protein uL11 Alkaliphilus oremlandii (strain OhILAs)
A5N4N5 4.11e-62 190 69 1 141 3 rplK Large ribosomal subunit protein uL11 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A3CPA6 4.25e-62 190 67 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus sanguinis (strain SK36)
Q88YX0 4.29e-62 190 68 1 141 3 rplK Large ribosomal subunit protein uL11 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3SSY4 4.53e-62 189 65 0 142 3 rplK Large ribosomal subunit protein uL11 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A0PXT4 4.79e-62 189 65 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium novyi (strain NT)
Q2GA45 5e-62 189 63 0 140 3 rplK Large ribosomal subunit protein uL11 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A6X0A5 5.17e-62 189 65 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C1CQB5 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJA5 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain P1031)
C1CD02 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain JJA)
Q8CWS9 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IMU7 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain CGSP14)
Q97RZ6 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZML8 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C5Z8 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain 70585)
B5E2M5 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 19F (strain G54)
Q04LP7 5.17e-62 189 68 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A7HWQ0 6.23e-62 189 65 0 140 3 rplK Large ribosomal subunit protein uL11 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B1IAH3 7.34e-62 189 67 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pneumoniae (strain Hungary19A-6)
A4W2B7 7.67e-62 189 67 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus suis (strain 98HAH33)
B8D0B2 8.29e-62 189 68 1 141 3 rplK Large ribosomal subunit protein uL11 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A0QS45 8.55e-62 189 69 1 139 1 rplK Large ribosomal subunit protein uL11 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q830Q5 1.04e-61 189 66 1 141 3 rplK Large ribosomal subunit protein uL11 Enterococcus faecalis (strain ATCC 700802 / V583)
B1HNL6 1.07e-61 189 66 1 142 3 rplK Large ribosomal subunit protein uL11 Lysinibacillus sphaericus (strain C3-41)
A8AY75 1.08e-61 189 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A4SGL0 1.13e-61 189 66 1 142 3 rplK Large ribosomal subunit protein uL11 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q2LQ91 1.23e-61 189 67 1 138 3 rplK Large ribosomal subunit protein uL11 Syntrophus aciditrophicus (strain SB)
C0Q9Y3 1.31e-61 188 67 1 140 3 rplK Large ribosomal subunit protein uL11 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
O87733 1.41e-61 188 67 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces lavendulae
Q0BYA0 1.57e-61 188 65 1 146 3 rplK Large ribosomal subunit protein uL11 Hyphomonas neptunium (strain ATCC 15444)
B8I5B5 1.58e-61 188 66 1 140 3 rplK Large ribosomal subunit protein uL11 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q2RFN5 1.58e-61 188 67 1 141 3 rplK Large ribosomal subunit protein uL11 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C0MHG3 1.63e-61 188 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U476 1.63e-61 188 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MBU0 1.63e-61 188 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus equi subsp. equi (strain 4047)
Q5N3N9 1.65e-61 188 64 1 142 3 rplK Large ribosomal subunit protein uL11 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q8G065 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella suis biovar 1 (strain 1330)
B0CH45 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YHQ1 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL5 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R4 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CP4 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella abortus biovar 1 (strain 9-941)
Q2YM11 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella abortus (strain 2308)
B2S691 1.74e-61 188 66 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella abortus (strain S19)
Q890N1 1.84e-61 188 66 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium tetani (strain Massachusetts / E88)
Q97EG5 1.97e-61 188 66 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q98N70 1.99e-61 188 65 0 140 3 rplK Large ribosomal subunit protein uL11 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MPU0 2.01e-61 188 64 1 141 3 rplK Large ribosomal subunit protein uL11 Lawsonia intracellularis (strain PHE/MN1-00)
Q8DM28 2.15e-61 188 63 1 142 3 rplK Large ribosomal subunit protein uL11 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1GT67 2.34e-61 188 64 0 142 3 rplK Large ribosomal subunit protein uL11 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B3QYL0 2.42e-61 188 66 1 141 3 rplK Large ribosomal subunit protein uL11 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A5VR19 2.67e-61 187 65 0 140 3 rplK Large ribosomal subunit protein uL11 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B0K5G4 3.12e-61 187 66 1 138 3 rplK Large ribosomal subunit protein uL11 Thermoanaerobacter sp. (strain X514)
B0KCI8 3.12e-61 187 66 1 138 3 rplK Large ribosomal subunit protein uL11 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A8ZUU5 3.19e-61 187 67 1 138 3 rplK Large ribosomal subunit protein uL11 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B9DRE8 3.33e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A1B011 4.35e-61 187 63 1 149 3 rplK Large ribosomal subunit protein uL11 Paracoccus denitrificans (strain Pd 1222)
B8DLM3 4.43e-61 187 65 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8E424 4.62e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype III (strain NEM316)
P36258 4.82e-61 187 68 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces griseus
B1W447 4.82e-61 187 68 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P56210 4.96e-61 187 68 1 134 1 rplK Large ribosomal subunit protein uL11 (Fragment) Geobacillus stearothermophilus
Q8DSX9 5.22e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q03IP3 6.28e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2J9 6.28e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXZ5 6.28e-61 187 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus thermophilus (strain CNRZ 1066)
Q82DQ9 6.7e-61 187 67 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1WCN3 6.93e-61 187 63 0 141 3 rplK Large ribosomal subunit protein uL11 Acidovorax sp. (strain JS42)
B9MH51 6.93e-61 187 63 0 141 3 rplK Large ribosomal subunit protein uL11 Acidovorax ebreus (strain TPSY)
Q1IHH0 7e-61 187 69 1 139 3 rplK Large ribosomal subunit protein uL11 Koribacter versatilis (strain Ellin345)
Q8DYG1 7.33e-61 186 65 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K003 7.33e-61 186 65 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P60102 8.73e-61 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A5V9F5 1.01e-60 186 64 1 142 3 rplK Large ribosomal subunit protein uL11 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q1BDJ6 1.03e-60 186 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium sp. (strain MCS)
A1UBE6 1.03e-60 186 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium sp. (strain KMS)
Q30X10 1.08e-60 186 66 1 141 3 rplK Large ribosomal subunit protein uL11 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B5XK61 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE01 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UX9 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RG33 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J835 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JI80 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JN34 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD61 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66059 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDH7 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE00 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66058 1.19e-60 186 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus pyogenes serotype M1
A1WK51 1.41e-60 186 62 0 141 3 rplK Large ribosomal subunit protein uL11 Verminephrobacter eiseniae (strain EF01-2)
A1TVT4 1.46e-60 186 62 0 141 3 rplK Large ribosomal subunit protein uL11 Paracidovorax citrulli (strain AAC00-1)
A6W5S6 1.52e-60 186 66 1 140 3 rplK Large ribosomal subunit protein uL11 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q03ST9 1.68e-60 186 67 1 141 3 rplK Large ribosomal subunit protein uL11 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B0TX06 1.76e-60 186 64 0 139 3 rplK Large ribosomal subunit protein uL11 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5NPL1 1.88e-60 186 64 0 140 3 rplK Large ribosomal subunit protein uL11 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C3MAW7 1.88e-60 186 62 0 140 3 rplK Large ribosomal subunit protein uL11 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8E0K3 2.21e-60 185 67 1 140 3 rplK Large ribosomal subunit protein uL11 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YEY0 2.21e-60 185 67 1 140 3 rplK Large ribosomal subunit protein uL11 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B8J1A4 2.29e-60 185 65 1 141 3 rplK Large ribosomal subunit protein uL11 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A0PM07 2.82e-60 185 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium ulcerans (strain Agy99)
B2HSH1 2.82e-60 185 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium marinum (strain ATCC BAA-535 / M)
A1VAK0 3.51e-60 185 67 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain DP4)
P62433 3.51e-60 185 67 1 141 3 rplK Large ribosomal subunit protein uL11 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B2TIG4 3.67e-60 185 64 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Eklund 17B / Type B)
B2UY99 3.67e-60 185 64 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium botulinum (strain Alaska E43 / Type E3)
O87085 3.7e-60 185 66 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces antibioticus
P27310 3.74e-60 185 65 1 139 3 rplK Large ribosomal subunit protein uL11 Streptomyces virginiae
A6LPQ0 4.77e-60 184 64 1 142 3 rplK Large ribosomal subunit protein uL11 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A3PV33 4.98e-60 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium sp. (strain JLS)
Q119S6 5.94e-60 184 62 1 142 3 rplK Large ribosomal subunit protein uL11 Trichodesmium erythraeum (strain IMS101)
A6U847 6.27e-60 184 62 0 140 3 rplK Large ribosomal subunit protein uL11 Sinorhizobium medicae (strain WSM419)
Q250P8 6.91e-60 184 64 1 140 3 rplK Large ribosomal subunit protein uL11 Desulfitobacterium hafniense (strain Y51)
B8G1V0 6.91e-60 184 64 1 140 3 rplK Large ribosomal subunit protein uL11 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A4VW09 6.92e-60 184 66 1 142 3 rplK Large ribosomal subunit protein uL11 Streptococcus suis (strain 05ZYH33)
B2GII3 7.79e-60 184 66 1 139 3 rplK Large ribosomal subunit protein uL11 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A7I3U3 7.9e-60 184 68 1 141 3 rplK Large ribosomal subunit protein uL11 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
C4ZB90 8.07e-60 184 65 1 142 3 rplK Large ribosomal subunit protein uL11 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B9KBJ9 8.25e-60 184 65 1 142 3 rplK Large ribosomal subunit protein uL11 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B0T065 9.29e-60 184 63 0 140 3 rplK Large ribosomal subunit protein uL11 Caulobacter sp. (strain K31)
Q8R7U2 9.62e-60 184 65 1 138 3 rplK Large ribosomal subunit protein uL11 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C0QQL2 1.06e-59 184 65 0 141 3 rplK Large ribosomal subunit protein uL11 Persephonella marina (strain DSM 14350 / EX-H1)
P9WHE5 1.17e-59 184 68 1 139 1 rplK Large ribosomal subunit protein uL11 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHE4 1.17e-59 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U025 1.17e-59 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKX3 1.17e-59 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGC0 1.17e-59 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66057 1.17e-59 184 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B8H0P4 1.29e-59 183 62 0 140 3 rplK Large ribosomal subunit protein uL11 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AAF9 1.29e-59 183 62 0 140 3 rplK Large ribosomal subunit protein uL11 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92QI1 1.35e-59 183 62 0 140 3 rplK Large ribosomal subunit protein uL11 Rhizobium meliloti (strain 1021)
A4T1M2 1.39e-59 183 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycolicibacterium gilvum (strain PYR-GCK)
Q0ANN9 1.56e-59 183 61 0 142 3 rplK Large ribosomal subunit protein uL11 Maricaulis maris (strain MCS10)
Q3ATP9 1.64e-59 183 65 1 142 3 rplK Large ribosomal subunit protein uL11 Chlorobium chlorochromatii (strain CaD3)
A1T4H0 2.04e-59 183 68 1 139 3 rplK Large ribosomal subunit protein uL11 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B0RIR7 2.07e-59 183 66 1 139 3 rplK Large ribosomal subunit protein uL11 Clavibacter sepedonicus
Q6AP82 2.21e-59 183 62 1 140 3 rplK Large ribosomal subunit protein uL11 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B0CAC9 2.26e-59 183 62 1 142 3 rplK Large ribosomal subunit protein uL11 Acaryochloris marina (strain MBIC 11017)
B2A4C6 2.39e-59 182 63 1 141 3 rplK Large ribosomal subunit protein uL11 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B8EMR7 2.55e-59 182 62 0 140 3 rplK Large ribosomal subunit protein uL11 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A1SEI6 2.69e-59 182 64 1 139 3 rplK Large ribosomal subunit protein uL11 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q3MA19 3.24e-59 182 62 1 142 3 rplK Large ribosomal subunit protein uL11 Trichormus variabilis (strain ATCC 29413 / PCC 7937)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13775
Feature type CDS
Gene rplK
Product 50S ribosomal protein L11
Location 3064155 - 3064583 (strand: -1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2285
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00298 Ribosomal protein L11, RNA binding domain
PF03946 Ribosomal protein L11, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0080 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L11

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02867 large subunit ribosomal protein L11 Ribosome -

Protein Sequence

MAKKVQAYIKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESVEKGLPIPVVITVYADRSFTFVTKTPPAAILLKKAAGVKSGSGKPNKEKVGKVTTAQVREIAETKAADLTGADVEAMMRSIEGTARSMGLVVED

Flanking regions ( +/- flanking 50bp)

AAATCGGGGAGCCCTAGCCGGGCGATATACCCACATTGAGGAATTAATTAATGGCTAAGAAAGTCCAAGCCTATATCAAACTGCAAGTTGCAGCAGGTATGGCTAATCCAAGTCCACCAGTTGGTCCAGCTCTGGGTCAACAAGGTGTTAACATCATGGAATTCTGTAAAGCATTCAACGCTAAAACTGAAAGCGTAGAAAAAGGTTTACCAATCCCTGTTGTTATTACAGTTTACGCAGACCGTTCTTTCACTTTCGTGACTAAAACTCCTCCAGCAGCGATTCTGCTGAAGAAAGCGGCGGGCGTGAAATCAGGTTCTGGCAAACCGAACAAAGAGAAAGTAGGTAAAGTAACTACTGCTCAAGTTCGTGAAATTGCAGAAACTAAAGCTGCGGATCTGACTGGTGCTGATGTTGAAGCTATGATGCGTTCAATTGAAGGTACTGCTCGTTCCATGGGCCTGGTAGTGGAGGACTAATCTGATGGCTAAACTAACCAAGCGCATGCGCAATATCCGTGAAAAAGTAG