Homologs in group_2295

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17630 FBDBKF_17630 68.1 Morganella morganii S1 thiE thiamine phosphate synthase
EHELCC_18115 EHELCC_18115 68.1 Morganella morganii S2 thiE thiamine phosphate synthase
NLDBIP_18035 NLDBIP_18035 68.1 Morganella morganii S4 thiE thiamine phosphate synthase
LHKJJB_18230 LHKJJB_18230 68.1 Morganella morganii S3 thiE thiamine phosphate synthase
HKOGLL_17970 HKOGLL_17970 68.1 Morganella morganii S5 thiE thiamine phosphate synthase
F4V73_RS15010 F4V73_RS15010 67.1 Morganella psychrotolerans thiE thiamine phosphate synthase

Distribution of the homologs in the orthogroup group_2295

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2295

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYU2 4.26e-159 441 100 0 215 3 thiE Thiamine-phosphate synthase Proteus mirabilis (strain HI4320)
Q7N964 2.93e-108 312 72 0 211 3 thiE Thiamine-phosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66FP6 7.36e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FNH7 7.36e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TS25 8.4e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pestis (strain Pestoides F)
Q1CN71 8.4e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAQ1 8.4e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pestis
Q1C1U8 8.4e-101 293 68 0 208 3 thiE Thiamine-phosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q6DAM1 7.65e-97 283 64 1 210 3 thiE Thiamine-phosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G8F3 1.27e-94 278 65 0 207 3 thiE Thiamine-phosphate synthase Serratia proteamaculans (strain 568)
A6TGQ0 3.16e-93 274 64 0 200 3 thiE Thiamine-phosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Z089 3.45e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6Y0 3.45e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O157:H7
Q3YUZ1 3.65e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Shigella sonnei (strain Ss046)
Q83PB9 4.34e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Shigella flexneri
Q0SY07 4.34e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Shigella flexneri serotype 5b (strain 8401)
B2TWI0 4.34e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I5K4 4.34e-93 274 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli (strain SE11)
A9N0K5 5.53e-93 273 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A4W5B6 5.71e-93 273 65 0 200 3 thiE Thiamine-phosphate synthase Enterobacter sp. (strain 638)
Q1R5V9 6.58e-93 273 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli (strain UTI89 / UPEC)
A1AIG4 6.58e-93 273 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O1:K1 / APEC
Q31U04 6.73e-93 273 63 0 200 3 thiE Thiamine-phosphate synthase Shigella boydii serotype 4 (strain Sb227)
A8A793 7.03e-93 273 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O9:H4 (strain HS)
Q9L9I8 8.85e-93 273 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57H62 8.94e-93 273 64 0 201 3 thiE Thiamine-phosphate synthase Salmonella choleraesuis (strain SC-B67)
Q0TA72 1.31e-92 273 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5RFJ1 2.01e-92 272 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYE8 2.01e-92 272 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FQK8 2.01e-92 272 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella dublin (strain CT_02021853)
B4TQK3 3.22e-92 271 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella schwarzengrund (strain CVM19633)
P30137 3.88e-92 271 63 0 200 1 thiE Thiamine-phosphate synthase Escherichia coli (strain K12)
B1IUQ4 3.88e-92 271 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZUK8 3.88e-92 271 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FB78 6.34e-92 271 63 0 200 3 thiE Thiamine-phosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5F1H6 1.54e-91 270 64 0 200 3 thiE Thiamine-phosphate synthase Salmonella agona (strain SL483)
Q32AG6 2.02e-91 270 63 0 200 3 thiE Thiamine-phosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
A7MJ80 2.07e-91 270 65 0 200 3 thiE Thiamine-phosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
A8AKT0 2.9e-91 269 63 0 200 3 thiE Thiamine-phosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BJR2 1.45e-90 267 63 0 200 3 thiE Thiamine-phosphate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PKA7 1.45e-90 267 63 0 200 3 thiE Thiamine-phosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z325 2.95e-90 266 63 0 200 3 thiE Thiamine-phosphate synthase Salmonella typhi
B4T0Z5 3.71e-90 266 62 0 200 3 thiE Thiamine-phosphate synthase Salmonella newport (strain SL254)
B4TCT2 4.88e-90 266 62 0 200 3 thiE Thiamine-phosphate synthase Salmonella heidelberg (strain SL476)
A9MHD7 1.02e-89 265 62 0 200 3 thiE Thiamine-phosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9JWI2 6.24e-54 174 47 0 203 3 thiE Thiamine-phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXF7 2.16e-52 170 46 0 203 3 thiE Thiamine-phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5F5C2 2.28e-51 167 46 0 203 3 thiE Thiamine-phosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
O34294 1.14e-43 148 43 0 180 3 thiE Thiamine-phosphate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3QNM2 1.05e-29 112 32 1 188 3 thiE Thiamine-phosphate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KD79 6.14e-28 107 32 1 187 3 thiE Thiamine-phosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
C0QR82 7.72e-27 105 34 3 211 3 thiE Thiamine-phosphate synthase Persephonella marina (strain DSM 14350 / EX-H1)
B5YA97 8.06e-27 105 35 1 188 3 thiE Thiamine-phosphate synthase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q8U192 1.13e-26 104 34 4 201 1 thiE Thiamine-phosphate synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A6UPE6 1.61e-26 104 33 4 203 3 thiE Thiamine-phosphate synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q9UZQ5 1.76e-26 103 35 5 204 3 thiE Thiamine-phosphate synthase Pyrococcus abyssi (strain GE5 / Orsay)
B8E358 2.31e-26 104 32 1 188 3 thiE Thiamine-phosphate synthase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A1BGM7 3.19e-26 103 34 1 180 3 thiE Thiamine-phosphate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A0Q2A0 3.2e-26 103 38 1 174 3 thiE Thiamine-phosphate synthase Clostridium novyi (strain NT)
Q3B4B1 4.8e-26 103 32 1 186 3 thiE Thiamine-phosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q38ZM1 1.46e-25 102 37 4 181 3 thiE Thiamine-phosphate synthase Latilactobacillus sakei subsp. sakei (strain 23K)
B7GKQ8 3.38e-25 100 33 3 207 3 thiE Thiamine-phosphate synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A5ULP4 7.78e-25 99 33 4 207 3 thiE Thiamine-phosphate synthase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
P61410 1.11e-24 99 34 2 193 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A0R981 1.22e-24 99 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus thuringiensis (strain Al Hakam)
B7JN72 1.23e-24 99 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain AH820)
C1EVE6 1.32e-24 99 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain 03BB102)
Q63GK3 1.59e-24 99 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain ZK / E33L)
Q9CG48 1.94e-24 99 30 2 186 3 thiE Thiamine-phosphate synthase Lactococcus lactis subsp. lactis (strain IL1403)
A4SEP8 2.11e-24 98 34 2 178 3 thiE Thiamine-phosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A4XG66 2.19e-24 99 33 1 187 3 thiE Thiamine-phosphate synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
P61413 2.83e-24 98 32 4 201 3 thiE Thiamine-phosphate synthase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q7V0I3 3.09e-24 101 33 3 189 3 thiE Thiamine-phosphate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B9J2L5 3.2e-24 98 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain Q1)
B7HT70 3.2e-24 98 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain AH187)
B9MN52 3.71e-24 98 33 1 187 3 thiE Thiamine-phosphate synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A7ZA58 3.89e-24 98 31 2 188 3 thiE Thiamine-phosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q6HP17 5.79e-24 97 34 2 190 3 thiE Thiamine-phosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q1MRJ6 7.21e-24 97 34 2 184 3 thiE Thiamine-phosphate synthase Lawsonia intracellularis (strain PHE/MN1-00)
O58878 1.03e-23 97 34 4 203 3 thiE Thiamine-phosphate synthase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
A9AAG9 1.18e-23 96 32 4 201 3 thiE Thiamine-phosphate synthase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A4FX32 1.42e-23 96 31 4 201 3 thiE Thiamine-phosphate synthase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
B3GX82 2.57e-23 96 33 2 185 3 thiE Thiamine-phosphate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
O66833 3.44e-23 95 32 3 197 3 thiE1 Thiamine-phosphate synthase 1 Aquifex aeolicus (strain VF5)
A6VG83 5.26e-23 95 31 4 201 3 thiE Thiamine-phosphate synthase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
B8I3J4 5.28e-23 95 34 2 188 3 thiE Thiamine-phosphate synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A0AFC5 1.01e-22 94 33 2 184 3 thiE Thiamine-phosphate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q03GM4 1.21e-22 94 32 3 194 3 thiE Thiamine-phosphate synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A9VRN4 1.26e-22 94 35 2 181 3 thiE Thiamine-phosphate synthase Bacillus mycoides (strain KBAB4)
Q81Z95 1.49e-22 94 33 2 190 3 thiE Thiamine-phosphate synthase Bacillus anthracis
C3L627 1.49e-22 94 33 2 190 3 thiE Thiamine-phosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBW1 1.49e-22 94 33 2 190 3 thiE Thiamine-phosphate synthase Bacillus anthracis (strain A0248)
Q65DK0 1.51e-22 94 32 2 191 3 thiE Thiamine-phosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9RGS5 3.35e-22 93 33 3 186 3 thiE Thiamine-phosphate synthase Staphylococcus carnosus (strain TM300)
P39594 4.57e-22 92 31 2 191 1 thiE Thiamine-phosphate synthase Bacillus subtilis (strain 168)
A4W0K4 5.56e-22 92 33 2 186 3 thiE Thiamine-phosphate synthase Streptococcus suis (strain 98HAH33)
Q8DQK4 8.74e-22 92 30 2 183 3 thiE1 Thiamine-phosphate synthase 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2GBV5 9.13e-22 92 32 2 184 3 thiE Thiamine-phosphate synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A8MK92 1.25e-21 91 35 2 170 3 thiE Thiamine-phosphate synthase Alkaliphilus oremlandii (strain OhILAs)
Q1IX16 1.45e-21 91 36 5 179 3 thiE Thiamine-phosphate synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A5D4K4 1.81e-21 91 31 1 174 3 thiE Thiamine-phosphate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q97RS5 2.12e-21 90 30 2 183 3 thiE1 Thiamine-phosphate synthase 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q186F8 3.82e-21 90 30 3 193 3 thiE Thiamine-phosphate synthase Clostridioides difficile (strain 630)
B7H7H5 3.98e-21 90 33 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain B4264)
P57930 5.57e-21 90 32 3 193 3 thiE Thiamine-phosphate synthase Pasteurella multocida (strain Pm70)
Q5WH87 7.49e-21 89 31 3 196 3 thiE Thiamine-phosphate synthase Shouchella clausii (strain KSM-K16)
Q81IG8 7.8e-21 89 33 2 190 3 thiE Thiamine-phosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q49Z39 1.21e-20 89 31 5 192 3 thiE Thiamine-phosphate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6L645 1.33e-20 88 32 3 181 3 thiE Thiamine-phosphate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A4IN28 1.36e-20 89 37 2 161 3 thiE Thiamine-phosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
A5WDP0 1.72e-20 88 37 7 213 3 thiE Thiamine-phosphate synthase Psychrobacter sp. (strain PRwf-1)
A7GKR4 2.18e-20 88 34 2 175 3 thiE Thiamine-phosphate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q92EW5 2.18e-20 88 32 2 183 3 thiE Thiamine-phosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B1HX34 2.19e-20 88 34 3 178 3 thiE Thiamine-phosphate synthase Lysinibacillus sphaericus (strain C3-41)
B2UY65 2.28e-20 88 34 3 183 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Alaska E43 / Type E3)
B4U6B2 2.67e-20 88 33 3 186 3 thiE Thiamine-phosphate synthase Hydrogenobaculum sp. (strain Y04AAS1)
Q7NNK8 2.67e-20 90 34 2 188 3 thiE Thiamine-phosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9KCY8 5.39e-20 87 35 1 165 3 thiE Thiamine-phosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4ZNA1 5.81e-20 87 33 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas syringae pv. syringae (strain B728a)
A9AZD9 6.58e-20 87 35 4 197 3 thiE Thiamine-phosphate synthase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q24XQ0 7.87e-20 86 31 1 186 3 thiE Thiamine-phosphate synthase Desulfitobacterium hafniense (strain Y51)
B5Y6I1 9.69e-20 86 32 2 175 3 thiE Thiamine-phosphate synthase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q97LQ9 1.05e-19 86 29 2 188 3 thiE Thiamine-phosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8CNK2 1.09e-19 86 32 4 184 3 thiE Thiamine-phosphate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMD0 1.09e-19 86 32 4 184 3 thiE Thiamine-phosphate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A7N7S3 1.46e-19 85 35 1 182 3 thiE Thiamine-phosphate synthase Vibrio campbellii (strain ATCC BAA-1116)
Q723Y9 1.78e-19 85 31 2 183 3 thiE Thiamine-phosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
B8FUD4 2.27e-19 85 32 1 175 3 thiE Thiamine-phosphate synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q48DP2 2.32e-19 85 33 4 194 3 thiE Thiamine-phosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2TQ13 2.76e-19 85 33 3 184 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Eklund 17B / Type B)
C1KZ34 3e-19 85 31 2 183 3 thiE Thiamine-phosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
A7NRF7 3.19e-19 85 30 1 184 3 thiE Thiamine-phosphate synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5UUL3 3.78e-19 85 31 1 180 3 thiE Thiamine-phosphate synthase Roseiflexus sp. (strain RS-1)
A2RKJ7 4.08e-19 85 30 2 174 3 thiE Thiamine-phosphate synthase Lactococcus lactis subsp. cremoris (strain MG1363)
B1MX63 4.61e-19 84 36 7 194 3 thiE Thiamine-phosphate synthase Leuconostoc citreum (strain KM20)
P41835 6.39e-19 87 32 5 228 3 THI6 Thiamine biosynthetic bifunctional enzyme Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q3K6C1 7.8e-19 84 32 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas fluorescens (strain Pf0-1)
Q9ZL01 7.88e-19 84 31 3 188 3 thiE Thiamine-phosphate synthase Helicobacter pylori (strain J99 / ATCC 700824)
B8DET0 9.55e-19 84 31 2 183 3 thiE Thiamine-phosphate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q1GXW1 1.05e-18 84 32 4 191 3 thiE Thiamine-phosphate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8YA44 1.14e-18 84 32 2 183 3 thiE Thiamine-phosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4K5I7 1.21e-18 83 31 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8M9N4 1.4e-18 83 30 5 195 3 thiE Thiamine-phosphate synthase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
A2BSJ5 1.69e-18 85 32 2 173 3 thiE Thiamine-phosphate synthase Prochlorococcus marinus (strain AS9601)
P72965 1.7e-18 85 34 2 187 3 thiE Thiamine-phosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6M1W6 1.71e-18 83 33 3 174 3 thiE Thiamine-phosphate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q21VL5 1.74e-18 83 32 1 176 3 thiE Thiamine-phosphate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8TMD6 2.33e-18 83 30 5 221 3 thiE Thiamine-phosphate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q87VY6 2.49e-18 82 33 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8UAS8 3.52e-18 82 36 2 140 3 thiE Thiamine-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8RI59 3.63e-18 82 30 2 185 3 thiE Thiamine-phosphate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q18GX9 4.04e-18 82 30 4 190 3 thiE Thiamine-phosphate synthase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q8DHK2 4.16e-18 84 35 6 195 3 thiE Thiamine-phosphate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5GMH7 4.49e-18 84 33 2 185 3 thiE Thiamine-phosphate synthase Synechococcus sp. (strain WH7803)
Q02YS6 4.63e-18 82 29 2 174 3 thiE Thiamine-phosphate synthase Lactococcus lactis subsp. cremoris (strain SK11)
Q830K5 4.78e-18 82 31 4 201 3 thiE Thiamine-phosphate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
B2USY5 6.31e-18 82 33 4 177 3 thiE Thiamine-phosphate synthase Helicobacter pylori (strain Shi470)
C3K2K2 1.04e-17 81 31 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas fluorescens (strain SBW25)
Q3IP34 1.51e-17 80 32 5 191 3 thiE Thiamine-phosphate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q2S2A8 1.67e-17 80 28 4 222 3 thiE Thiamine-phosphate synthase Salinibacter ruber (strain DSM 13855 / M31)
A6GWR9 2.03e-17 80 31 1 182 3 thiE Thiamine-phosphate synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q5LCA7 2.1e-17 80 31 3 190 3 thiE Thiamine-phosphate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q0I131 2.23e-17 80 31 5 195 3 thiE Thiamine-phosphate synthase Histophilus somni (strain 129Pt)
A3CS45 2.55e-17 80 33 1 167 3 thiE Thiamine-phosphate synthase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
O28205 2.72e-17 80 33 4 203 3 thiE Thiamine-phosphate synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q0STA1 2.97e-17 79 25 2 190 3 thiE Thiamine-phosphate synthase Clostridium perfringens (strain SM101 / Type A)
A9WDL8 3.41e-17 79 34 2 152 3 thiE Thiamine-phosphate synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q2YUL2 3.81e-17 79 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1CT27 4.35e-17 79 32 4 187 3 thiE Thiamine-phosphate synthase Helicobacter pylori (strain HPAG1)
O48881 4.5e-17 82 30 5 199 1 BTH1 Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic Brassica napus
A4VQX9 4.5e-17 79 32 6 196 3 thiE Thiamine-phosphate synthase Stutzerimonas stutzeri (strain A1501)
A8IGE6 4.61e-17 79 32 5 210 3 thiE Thiamine-phosphate synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q64TA1 4.62e-17 79 31 3 190 3 thiE Thiamine-phosphate synthase Bacteroides fragilis (strain YCH46)
C3L061 4.71e-17 79 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain 657 / Type Ba4)
P40386 6.19e-17 82 31 5 198 2 thi4 Probable thiamine biosynthetic bifunctional enzyme Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q893R0 6.26e-17 79 31 4 172 3 thiE Thiamine-phosphate synthase Clostridium tetani (strain Massachusetts / E88)
Q3JDH3 6.41e-17 79 32 2 181 3 thiE Thiamine-phosphate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q87JW8 6.45e-17 79 33 1 183 3 thiE Thiamine-phosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0AZ86 7.63e-17 79 30 1 186 3 thiE Thiamine-phosphate synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
O25514 8.01e-17 79 31 4 187 3 thiE Thiamine-phosphate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B1KV12 8.61e-17 78 30 2 202 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Loch Maree / Type A3)
Q5SKG9 9.44e-17 78 32 3 189 3 thiE Thiamine-phosphate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72KL8 9.44e-17 78 32 3 189 3 thiE Thiamine-phosphate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P71350 9.64e-17 79 30 2 186 1 thiE Thiamine-phosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5HYZ3 9.66e-17 78 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPT0 9.66e-17 78 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain ATCC 19397 / Type A)
B1IEG6 1.11e-16 78 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Okra / Type B1)
C1FSC1 1.12e-16 78 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Kyoto / Type A2)
Q5KZU0 1.18e-16 78 34 3 163 3 thiE Thiamine-phosphate synthase Geobacillus kaustophilus (strain HTA426)
A7GAL0 1.2e-16 78 31 1 172 3 thiE Thiamine-phosphate synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A6VPG9 1.2e-16 78 28 2 192 3 thiE Thiamine-phosphate synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5M731 1.24e-16 81 30 5 202 1 TH1 Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic Arabidopsis thaliana
B0SMR9 1.49e-16 78 31 2 175 3 thiE Thiamine-phosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SE83 1.49e-16 78 31 2 175 3 thiE Thiamine-phosphate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5UGT0 1.5e-16 78 30 2 186 3 thiE Thiamine-phosphate synthase Haemophilus influenzae (strain PittGG)
Q2QWK9 2.4e-16 80 31 6 205 2 Os12g0192500 Probable thiamine biosynthetic bifunctional enzyme, chloroplastic Oryza sativa subsp. japonica
Q7U5U1 2.46e-16 79 32 1 187 3 thiE Thiamine-phosphate synthase Parasynechococcus marenigrum (strain WH8102)
A5UA71 2.65e-16 77 29 2 186 3 thiE Thiamine-phosphate synthase Haemophilus influenzae (strain PittEE)
Q4QNC6 2.65e-16 77 29 2 186 3 thiE Thiamine-phosphate synthase Haemophilus influenzae (strain 86-028NP)
Q6GEY4 2.68e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain MRSA252)
Q8R806 2.9e-16 77 30 5 200 3 thiE Thiamine-phosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1ILG3 3.08e-16 77 31 4 182 3 thiE Thiamine-phosphate synthase Koribacter versatilis (strain Ellin345)
Q8AA13 3.22e-16 77 30 1 181 3 thiE Thiamine-phosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P61411 3.26e-16 77 32 1 187 3 thiE Putative thiamine-phosphate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P66919 3.61e-16 77 27 2 186 1 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain N315)
P66918 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIT5 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain Newman)
Q5HEA8 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain COL)
A5IUN7 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain JH9)
Q2FWG3 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF35 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain USA300)
A6U3H7 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain JH1)
A7X4S8 3.61e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8XKQ8 3.74e-16 77 24 2 190 3 thiE Thiamine-phosphate synthase Clostridium perfringens (strain 13 / Type A)
Q8NVH5 4.44e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain MW2)
Q6G7L9 4.44e-16 77 27 2 186 3 thiE Thiamine-phosphate synthase Staphylococcus aureus (strain MSSA476)
Q466J5 4.77e-16 77 28 5 206 3 thiE Thiamine-phosphate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q0IC17 5.81e-16 78 33 2 180 3 thiE Thiamine-phosphate synthase Synechococcus sp. (strain CC9311)
A5W9G9 6.35e-16 76 30 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
O67378 7.12e-16 75 29 3 168 3 thiE2 Putative thiamine-phosphate synthase 2 Aquifex aeolicus (strain VF5)
Q8E5W9 7.66e-16 76 30 3 206 3 thiE Thiamine-phosphate synthase Streptococcus agalactiae serotype III (strain NEM316)
P66921 7.67e-16 76 29 2 189 3 thiE2 Thiamine-phosphate synthase 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66920 7.67e-16 76 29 2 189 3 thiE2 Thiamine-phosphate synthase 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9HIQ4 9.25e-16 75 31 8 200 3 thiE Thiamine-phosphate synthase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q2RGI8 9.62e-16 75 31 2 170 3 thiE Thiamine-phosphate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B2G7Q4 9.88e-16 75 29 3 192 3 thiE Thiamine-phosphate synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKA1 9.88e-16 75 29 3 192 3 thiE Thiamine-phosphate synthase Limosilactobacillus reuteri (strain DSM 20016)
Q88DP1 9.9e-16 75 30 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8E092 1.01e-15 76 31 2 186 3 thiE Thiamine-phosphate synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1L6 1.01e-15 76 31 2 186 3 thiE Thiamine-phosphate synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q0TQV4 1.17e-15 75 24 2 190 3 thiE Thiamine-phosphate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0W1L8 1.21e-15 75 28 4 187 3 thiE Thiamine-phosphate synthase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q4L7X3 1.26e-15 75 28 3 183 3 thiE Thiamine-phosphate synthase Staphylococcus haemolyticus (strain JCSC1435)
A6TMN5 1.28e-15 75 32 2 170 3 thiE Thiamine-phosphate synthase Alkaliphilus metalliredigens (strain QYMF)
Q7UQH1 1.85e-15 77 28 3 190 3 thiE Thiamine-phosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8PS49 1.86e-15 75 28 5 208 3 thiE Thiamine-phosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q7VAV5 1.99e-15 77 31 2 166 3 thiE Thiamine-phosphate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q1I4H6 2.19e-15 74 30 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas entomophila (strain L48)
A0LTK3 2.5e-15 74 30 4 184 3 thiE Thiamine-phosphate synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B8GLE3 3.52e-15 74 29 4 210 3 thiE Thiamine-phosphate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q602R3 4.03e-15 74 28 6 222 3 thiE Thiamine-phosphate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8YX72 4.89e-15 75 33 4 180 3 thiE Thiamine-phosphate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5P6J5 5.26e-15 73 31 10 212 3 thiE Thiamine-phosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0AFV0 7.36e-15 73 28 4 192 3 thiE Thiamine-phosphate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C1DCM3 8.71e-15 73 32 5 186 3 thiE Thiamine-phosphate synthase Laribacter hongkongensis (strain HLHK9)
A8FIR6 1e-14 73 30 2 188 3 thiE Thiamine-phosphate synthase Bacillus pumilus (strain SAFR-032)
B7V9E0 1.15e-14 73 30 4 182 3 thiE Thiamine-phosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q2KUS6 1.17e-14 73 31 9 203 3 thiE Thiamine-phosphate synthase Bordetella avium (strain 197N)
Q8PH45 1.22e-14 72 39 3 130 3 thiE Thiamine-phosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
Q7W049 1.22e-14 73 31 5 177 3 thiE Thiamine-phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3U2 1.22e-14 73 31 5 177 3 thiE Thiamine-phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q6KZH9 1.28e-14 72 31 7 184 3 thiE Thiamine-phosphate synthase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
B0KJV8 1.46e-14 72 30 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas putida (strain GB-1)
Q02SE4 1.62e-14 72 30 4 182 3 thiE Thiamine-phosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7WF72 1.88e-14 72 31 5 177 3 thiE Thiamine-phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A0QQK7 2.29e-14 72 32 6 186 3 thiE Thiamine-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B0SUK3 2.43e-14 72 32 5 140 3 thiE Thiamine-phosphate synthase Caulobacter sp. (strain K31)
Q0VSP5 2.91e-14 72 28 6 197 3 thiE Thiamine-phosphate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q65US7 3.42e-14 72 27 2 180 3 thiE Thiamine-phosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8FTH8 3.6e-14 73 29 4 195 3 thiED Thiamine biosynthesis multifunctional protein ThiED Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P61422 3.96e-14 73 30 5 190 3 thiDE Thiamine biosynthesis bifunctional protein ThiED Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A6V0D3 5.13e-14 71 30 4 182 3 thiE Thiamine-phosphate synthase Pseudomonas aeruginosa (strain PA7)
Q3AL68 6.38e-14 72 30 5 198 3 thiE Thiamine-phosphate synthase Synechococcus sp. (strain CC9605)
C4XIJ2 7.28e-14 70 31 1 145 3 thiE Thiamine-phosphate synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9HX40 8.05e-14 70 30 4 182 3 thiE Thiamine-phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3SFU7 8.4e-14 70 28 5 206 3 thiE Thiamine-phosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
A5FJJ1 9.95e-14 70 31 5 193 3 thiE Thiamine-phosphate synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B1J1Y7 1.21e-13 70 30 4 196 3 thiE Thiamine-phosphate synthase Pseudomonas putida (strain W619)
Q21MI9 1.35e-13 70 31 5 194 3 thiE Thiamine-phosphate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2J6F7 1.5e-13 71 31 2 187 3 thiE Thiamine-phosphate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A2CB21 1.53e-13 71 32 5 189 3 thiE Thiamine-phosphate synthase Prochlorococcus marinus (strain MIT 9303)
C1DMY6 1.66e-13 69 28 4 182 3 thiE Thiamine-phosphate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2IM25 1.8e-13 70 32 5 179 3 thiE Thiamine-phosphate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
A4XYV5 2.48e-13 69 30 4 194 3 thiE Thiamine-phosphate synthase Pseudomonas mendocina (strain ymp)
Q2FM63 4.49e-13 68 27 5 198 3 thiE Thiamine-phosphate synthase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q7V8I3 5.13e-13 70 31 5 189 3 thiE Thiamine-phosphate synthase Prochlorococcus marinus (strain MIT 9313)
Q03NS1 6.21e-13 68 28 4 183 3 thiE Thiamine-phosphate synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1D282 9.18e-13 68 28 0 142 3 thiE Thiamine-phosphate synthase Myxococcus xanthus (strain DK1622)
Q8FP55 9.57e-13 67 26 5 189 3 thiE Thiamine-phosphate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8ESZ3 1.17e-12 67 28 3 188 3 thiE Thiamine-phosphate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4JVZ1 1.39e-12 67 33 3 136 3 thiE Thiamine-phosphate synthase Corynebacterium jeikeium (strain K411)
B3W783 2.63e-12 66 33 5 166 3 thiE Thiamine-phosphate synthase Lacticaseibacillus casei (strain BL23)
Q2Y5Q6 3.73e-12 66 27 5 208 3 thiE Thiamine-phosphate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6SUR1 3.79e-12 66 28 3 187 3 thiE Thiamine-phosphate synthase Janthinobacterium sp. (strain Marseille)
A7IA09 1.09e-11 65 30 4 182 3 thiE Thiamine-phosphate synthase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q8P5R7 1.68e-11 64 34 3 130 3 thiE Thiamine-phosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UYA4 1.68e-11 64 34 3 130 3 thiE Thiamine-phosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q97BE8 2.09e-11 64 31 9 198 3 thiE Thiamine-phosphate synthase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A0QLT6 3.04e-11 63 30 4 180 3 thiE Thiamine-phosphate synthase Mycobacterium avium (strain 104)
Q9RYX9 3.69e-11 64 34 4 168 3 thiE Thiamine-phosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1BEL9 4.01e-11 63 27 2 192 3 thiE Thiamine-phosphate synthase Mycobacterium sp. (strain MCS)
A1UAB4 4.01e-11 63 27 2 192 3 thiE Thiamine-phosphate synthase Mycobacterium sp. (strain KMS)
Q82AF9 4.52e-11 63 31 2 176 3 thiE Thiamine-phosphate synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5V0G6 5.08e-11 63 28 1 171 3 thiE Thiamine-phosphate synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9PGC4 6.02e-11 63 28 6 183 3 thiE Thiamine-phosphate synthase Xylella fastidiosa (strain 9a5c)
B3ED41 6.25e-11 62 32 0 121 3 thiE Thiamine-phosphate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q890C0 6.33e-11 62 31 5 193 3 thiE Thiamine-phosphate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87AX6 7.88e-11 62 28 6 183 3 thiE Thiamine-phosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A3PTW9 8.24e-11 62 27 2 192 3 thiE Thiamine-phosphate synthase Mycobacterium sp. (strain JLS)
Q82UQ7 8.82e-11 62 28 6 207 3 thiE Thiamine-phosphate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WYL4 9.21e-11 62 33 5 156 3 thiE Thiamine-phosphate synthase Halorhodospira halophila (strain DSM 244 / SL1)
P61412 1e-10 62 30 4 180 3 thiE Thiamine-phosphate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WG75 1.21e-10 62 29 5 194 1 thiE Thiamine-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG74 1.21e-10 62 29 5 194 3 thiE Thiamine-phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZE0 1.21e-10 62 29 5 194 3 thiE Thiamine-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KFN6 1.21e-10 62 29 5 194 3 thiE Thiamine-phosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66917 1.21e-10 62 29 5 194 3 thiE Thiamine-phosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q03CB2 1.44e-10 62 33 3 136 3 thiE Thiamine-phosphate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B5ERP0 1.98e-10 61 26 6 215 3 thiE Thiamine-phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBI2 1.98e-10 61 26 6 215 3 thiE Thiamine-phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q9PNL3 2.93e-10 60 30 2 173 3 thiE Thiamine-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HU23 2.96e-10 60 30 2 173 3 thiE Thiamine-phosphate synthase Campylobacter jejuni (strain RM1221)
Q9ZBL5 3.26e-10 61 30 7 186 3 thiE Thiamine-phosphate synthase Mycobacterium leprae (strain TN)
B8ZU95 3.26e-10 61 30 7 186 3 thiE Thiamine-phosphate synthase Mycobacterium leprae (strain Br4923)
B6INN5 5.67e-10 60 27 3 160 3 thiE Thiamine-phosphate synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
A6W6A2 1.25e-09 59 28 3 160 3 thiE Thiamine-phosphate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A7IGG9 1.26e-09 59 31 2 203 3 thiE Thiamine-phosphate synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A1W068 1.31e-09 59 28 2 173 3 thiE Thiamine-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FMD4 1.31e-09 59 28 2 173 3 thiE Thiamine-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A4T2R5 1.65e-09 59 30 2 148 3 thiE Thiamine-phosphate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q8NQH1 1.67e-09 60 27 3 174 3 theD Thiamine biosynthesis multifunctional protein ThiED Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A1T2Z5 2.07e-09 58 31 5 185 3 thiE Thiamine-phosphate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A8M4E6 2.08e-09 58 27 4 184 3 thiE Thiamine-phosphate synthase Salinispora arenicola (strain CNS-205)
Q478V2 2.27e-09 58 30 8 199 3 thiE Thiamine-phosphate synthase Dechloromonas aromatica (strain RCB)
A4XBL2 4.17e-09 57 28 6 203 3 thiE Thiamine-phosphate synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A1KB60 4.59e-09 57 29 5 202 3 thiE Thiamine-phosphate synthase Azoarcus sp. (strain BH72)
Q9S2V2 5.4e-09 57 30 2 172 3 thiE Thiamine-phosphate synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q47R33 5.49e-09 57 30 4 186 3 thiE Thiamine-phosphate synthase Thermobifida fusca (strain YX)
A1TYG6 8.25e-09 57 27 4 192 3 thiE Thiamine-phosphate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B2HPZ9 8.57e-09 57 32 1 120 3 thiE Thiamine-phosphate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
A4F727 1.02e-08 57 31 6 183 3 thiE Thiamine-phosphate synthase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A0PRY2 1.07e-08 56 32 1 120 3 thiE Thiamine-phosphate synthase Mycobacterium ulcerans (strain Agy99)
Q4FN35 1.38e-08 56 28 6 178 3 thiE Thiamine-phosphate synthase Pelagibacter ubique (strain HTCC1062)
Q5YNP9 1.43e-08 56 27 5 198 3 thiE Thiamine-phosphate synthase Nocardia farcinica (strain IFM 10152)
Q2NB00 2.05e-08 55 28 4 171 3 thiE Thiamine-phosphate synthase Erythrobacter litoralis (strain HTCC2594)
Q0BXD3 4.73e-08 55 26 6 173 3 thiE Thiamine-phosphate synthase Hyphomonas neptunium (strain ATCC 15444)
Q67T51 7.11e-08 55 29 3 142 3 thiM/thiE Thiamine biosynthesis bifunctional protein ThiM/ThiE Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q824E9 1.59e-07 53 25 1 160 3 thiE Thiamine-phosphate synthase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q7M9N9 1.59e-07 53 25 4 171 3 thiE Thiamine-phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5L6R5 5.59e-07 51 26 1 195 3 thiE Thiamine-phosphate synthase Chlamydia abortus (strain DSM 27085 / S26/3)
A0JYP1 3.71e-06 49 25 4 199 3 thiE Thiamine-phosphate synthase Arthrobacter sp. (strain FB24)
P25053 7.59e-06 48 24 5 192 1 tenI Thiazole tautomerase Bacillus subtilis (strain 168)
Q7P1R3 8.74e-05 45 35 1 82 3 thiE Thiamine-phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13720
Feature type CDS
Gene thiE
Product thiamine phosphate synthase
Location 3048655 - 3049302 (strand: 1)
Length 648 (nucleotides) / 215 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2295
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02581 Thiamine monophosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0352 Coenzyme transport and metabolism (H) H Thiamine monophosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MNRSSNSAFAPTEKKLGLYPVVDSIEWVERLLKIGVTTIQLRIKDKQPKDVEQDIITAIKLGRKYNARLFINDYWQLAIKHHAYGVHLGQEDLDIADLDAIKQSGLCLGISTHNDTELQRAKRLLPSYIALGHIFPTTTKDMPSKPQGLRALKHQVEQTHDFPTVAIGGISLEKVSDVVATGVGGVALVSAITKASDWQQVTLKLLELVEGKPSC

Flanking regions ( +/- flanking 50bp)

TAGTGAGCTATACCACAGTGCAGAAATAGCCAGTTCCGAGGTAGCTGATAATGAACAGATCCTCTAATTCGGCTTTTGCCCCAACCGAAAAAAAGTTGGGGCTTTACCCTGTTGTCGATTCTATTGAATGGGTTGAGCGCCTGTTGAAAATAGGTGTAACAACGATCCAATTACGCATCAAAGATAAACAGCCCAAAGATGTTGAACAAGATATAATCACTGCAATCAAATTAGGTCGTAAGTATAACGCAAGATTATTTATCAATGATTATTGGCAACTCGCCATTAAACATCACGCTTATGGTGTTCATCTTGGACAAGAAGATCTCGACATTGCCGATCTTGATGCTATTAAACAGTCAGGTTTATGCCTTGGTATTTCCACCCATAATGACACTGAACTACAAAGAGCAAAAAGGTTACTTCCCTCTTATATTGCTTTAGGGCATATATTTCCAACGACGACGAAAGATATGCCATCAAAGCCACAAGGTTTAAGAGCACTCAAACATCAAGTAGAACAAACTCATGATTTTCCAACCGTTGCTATTGGCGGGATCTCTCTAGAAAAAGTCTCTGATGTCGTAGCAACTGGCGTTGGTGGAGTTGCTTTAGTGAGTGCAATAACAAAGGCATCAGACTGGCAACAGGTAACACTTAAATTATTAGAATTAGTAGAGGGAAAACCATCATGCTAAATGATAATGATTTTATGCGTTATAGCCGACAAGTGATGTTAGAAGATATA